KEGG   Tessaracoccus sp. T2.5-30: BKM78_14790Help
Entry
BKM78_14790       CDS       T04747                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tez  Tessaracoccus sp. T2.5-30
Pathway
tez00010  Glycolysis / Gluconeogenesis
tez00030  Pentose phosphate pathway
tez00051  Fructose and mannose metabolism
tez00052  Galactose metabolism
tez00680  Methane metabolism
tez01100  Metabolic pathways
tez01110  Biosynthesis of secondary metabolites
tez01120  Microbial metabolism in diverse environments
tez01130  Biosynthesis of antibiotics
tez01200  Carbon metabolism
tez01230  Biosynthesis of amino acids
tez03018  RNA degradation
Module
tez_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BKM78_14790
   00030 Pentose phosphate pathway
    BKM78_14790
   00051 Fructose and mannose metabolism
    BKM78_14790
   00052 Galactose metabolism
    BKM78_14790
  09102 Energy metabolism
   00680 Methane metabolism
    BKM78_14790
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BKM78_14790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tez01009]
    BKM78_14790
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tez03019]
    BKM78_14790
Enzymes [BR:tez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BKM78_14790
Protein phosphatases and associated proteins [BR:tez01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BKM78_14790
Messenger RNA biogenesis [BR:tez03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BKM78_14790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AQX17040
LinkDB All DBs
Position
3209689..3211899
Genome map
AA seq 736 aa AA seqDB search
MTVRIGVMTSGGDAQGMNAAVRAIVRTGIHEGAEVFAIREGWQGAIQGGEHIVRLGWSDV
SGILSKGGTVIGTARSAEFRTREGQLTAVANLIEKGIDRLIVIGGDGSLTGSRHLCLGWP
EYVAELVEAGRITPEQAAQHPRLYIAGLVGSIDNDMVGTDMTIGTDSALHRITEAIDAIS
STAESHRRTFIVEVMGRHCGYLALMSAIAGGADYTFLPESPPRPGWEDRMVDVLARGRAA
GRRDSILIVAEGAADRDGTPITASRIQDVLRERTGEEARITILGHVQRGGTPSAYDRWMA
TACGVEAVRQVLDAEPDSEPVLVGVHRDAVHTTGLLSAVEATHRIGDYIASADYDAAVAA
RGHGFLTMIDIYRMLHEARPSVSPPETPRRIAVMHAGALAPGMNQLARVAVRAGLDLGYE
MMAVIGGVPGLINGDLRQVGWSDVEGMAHTGGAAFGTRRYVPQESELYQMARSLEDHGVD
ALLVMGGFHAYATVDLMERERRRYPAFNIPLALLPASIDNNLPGWPMAVGADTALNTIVS
SIDMVRMSASASKRAFVVETMGRTCGFLPLLGGIAGGAEKAYLPESGITLEQLSADIEAL
VDAFETGRSFYLAVMGEETSEHYTADVLARLFEAEGRGLYSVRRALIGHVQQGGTPSPFD
RINATRLAYQALVNLDRQLQSGTDDYVAAHSGTPGLMAPLRDVTDHMDWERQRPREQWWL
RLRAVFDQLSRKPGQE
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgcgcatcggcgtcatgacctcgggcggggatgcccagggcatgaacgcggcg
gtgcgcgcgatcgtgcggaccggcatccacgagggtgccgaggtcttcgccatccgggag
gggtggcagggcgccatccagggcggcgagcacatcgtgcgcctgggctggagcgacgtg
tccggcatcctcagcaagggcgggaccgtgatcggcaccgcccggtccgcggagttccgg
acgcgtgaggggcagctcaccgcagtggccaacctcatcgagaagggcatcgaccgactc
atcgtcatcggcggcgacggatccctcaccggcagcagacatctgtgcctgggctggccc
gagtacgtcgcggagctcgtcgaggccggccgcatcacccccgagcaggcggcgcagcac
ccccggctgtacatcgcggggctcgtgggatccatcgacaacgacatggtcggcaccgac
atgaccatcggcaccgattcggccctgcaccgcatcacggaggcgatcgacgcgatcagc
tccaccgcggagtcccaccgccgcaccttcatcgtcgaggtcatgggccgccactgcggc
tacctcgccctgatgagcgcgatcgccggcggggccgactacacgttcctgcccgagtcg
ccgccgcgtccgggctgggaggaccgcatggtcgacgtcctggcccgcggccgcgccgcg
ggtcgccgcgactccatcctcatcgtcgccgagggcgcggccgaccgcgacgggacgccc
atcacggcctcccgcatccaggacgtcctgcgtgagcgcaccggcgaagaggcccggatc
accatcctcggccacgtccagcgcggcggcacgccgtcggcctacgacaggtggatggcc
accgcgtgcggggtcgaggcggtcaggcaggtgctcgacgccgagccggacagcgaaccg
gtcctcgtcggcgtccatcgcgacgccgtgcataccaccgggctgctctcggcggtggag
gccacgcaccggatcggtgactacatcgcctcggcggactacgacgccgccgtggcggcg
cggggccatggcttcctcaccatgatcgacatctaccgcatgctgcacgaggccaggccc
agcgtgtccccaccggagacgccgcgccggatcgccgtcatgcatgccggtgccctcgcg
cccggcatgaaccagttggcgcgcgtcgccgtccgcgccggcctcgacctcgggtacgag
atgatggccgtgatcgggggcgtgcccggcctcatcaacggggacctgcgtcaggtcggc
tggtccgacgtcgagggcatggcacacacgggtggagccgcgttcgggacgcgccggtac
gtgccgcaggagagcgagctctaccagatggcccggagcctcgaggaccacggcgtcgac
gcgctgctcgtcatgggcgggttccacgcctacgccaccgtcgacctgatggagcgggag
cgccgcaggtatcccgccttcaacatcccgctcgcgctgctgccggccagcatcgacaac
aacctccccggctggcccatggctgtgggcgccgacacggcgctcaacaccatcgtgtcc
tccatcgacatggtgcgcatgtctgcgtcggcgagcaagcgcgccttcgtcgtcgagacc
atgggccgcacctgcgggttcctgccgctcctcggtggcatcgccggcggcgccgagaag
gcgtacctgccggagtcgggcatcacgctggagcagctgtcggccgacatcgaggcgctg
gtcgacgccttcgagaccggccgcagcttctatctcgccgtcatgggggaggagaccagc
gagcactacaccgccgacgtcctcgcccgactgttcgaggcggagggtcgcgggctgtac
tccgtccggagggcgctcatcggccacgtgcagcagggcggcacgccgtcgccgttcgac
cgcatcaacgcgacccgcctggcctaccaggcgctggtcaatctcgaccgccagctgcag
agcggaacggacgactacgtggccgcccacagcgggacgccgggcctcatggcgccgctg
cgcgacgtgaccgaccacatggactgggagcggcagcgcccccgggaacagtggtggctg
cgcctgcgggcggtgttcgaccagctgagccggaagccgggccaggagtga

DBGET integrated database retrieval system