KEGG   Tessaracoccus flavescens: BW733_07555Help
Entry
BW733_07555       CDS       T04703                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
tfa  Tessaracoccus flavescens
Pathway
tfa00020  Citrate cycle (TCA cycle)
tfa00190  Oxidative phosphorylation
tfa00650  Butanoate metabolism
tfa01100  Metabolic pathways
tfa01110  Biosynthesis of secondary metabolites
tfa01120  Microbial metabolism in diverse environments
tfa01130  Biosynthesis of antibiotics
tfa01200  Carbon metabolism
Module
tfa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tfa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BW733_07555
   00650 Butanoate metabolism
    BW733_07555
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BW733_07555
Enzymes [BR:tfa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BW733_07555
    1.3.5.4  fumarate reductase (quinol)
     BW733_07555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_17 Fer4_10 Fer4 Fer4_9 Fer4_4 Fer4_6 Fer4_2 Fer4_3 Fer2 Fer4_15 Fer4_16 Fer4_18 Fer4_21 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AQP50707
UniProt: A0A1Q2CXB9
LinkDB All DBs
Position
1559704..1560450
Genome map
AA seq 248 aa AA seqDB search
MRLTVEIWRQAGPEAPGAFEAHQIDGVDPHLSVLELLDALNEQLIDSGHEPFAFESDCRE
GICGACGVTVDGDVHGPEDNVPSCHQRLVHYADGSTVRIEPMRSAAFPVLRDLIVDRGGL
DDVIRAGGHVAVDAGTAPDADAIPIPTLTAEESLDFAACIGCGACVAACPNGAAHLFAGA
KLTHLAMLPIPSQERTRRARAMVTELEDLFGPCSLYGECERACPAGIPLTAIAAVNHERF
LAGIRRQL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagactcacagtggagatctggcgccaggcgggccctgaggcgccgggcgccttcgaa
gcgcaccagatcgacggcgtggacccgcacctctccgtcctcgagctgctcgacgcgctc
aacgagcagctgatcgactccggccacgagccgttcgccttcgagtccgactgccgagag
ggcatctgcggcgcctgtggcgtcaccgtcgacggcgacgtgcacggaccggaggacaat
gtgcccagctgtcaccagcggctcgtgcactacgcggacgggtcgaccgtgcggatcgag
ccgatgcgctcggcggcgttcccagtcttgcgcgacctgatcgtcgaccgaggtgggctc
gacgacgtgatccgggcaggcggccacgtcgccgtcgacgccgggacggccccggacgcc
gatgcgatcccgatccccacgctgacggccgaggagtcgctggacttcgcagcctgcatc
ggctgcggagcgtgcgtcgccgcctgccccaacggcgcggcccatctgttcgccggggcg
aagctgacgcatctggccatgcttcccatcccgtcacaggaacgcacgcgtcgggcccgc
gccatggtgaccgagttggaggacctgttcggcccctgctcgctgtacggggagtgtgag
cgggcctgccctgcggggatcccgctgacggcgatcgccgccgtcaaccacgaacgcttc
ctggcggggatccgtcgccaactctga

DBGET integrated database retrieval system