KEGG   Tessaracoccus flavescens: BW733_15220Help
Entry
BW733_15220       CDS       T04703                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tfa  Tessaracoccus flavescens
Pathway
tfa00473  D-Alanine metabolism
tfa00550  Peptidoglycan biosynthesis
tfa01100  Metabolic pathways
tfa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tfa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BW733_15220
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BW733_15220
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BW733_15220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tfa01011]
    BW733_15220
Enzymes [BR:tfa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BW733_15220
Peptidoglycan biosynthesis and degradation proteins [BR:tfa01011]
 Precursor biosynthesis
  Amino acid ligase
   BW733_15220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AQP51971
UniProt: A0A1Q2D114
LinkDB All DBs
Position
3104309..3105421
Genome map
AA seq 370 aa AA seqDB search
MSDRKRVALIFGGQSSEHGISCLTASSVLKAIDKDRFEVVGVGITKNGTWEQVPLEVIEN
YAIVDGVAPEVEEAPHEAVWMVGENGCEVATREGETLVDIHGVDVAFALLHGPYGEDGTI
QGLFEMMGIRYVGSGVTASAIGMDKHFMKVAFEAAGLPVYPYVAASALRLEQDRDAVLAE
INKLTYPLFVKPARGGSSIGISRVSDPSELEAAIAEAQKFDPKIVVEQGLVGARELECAV
LGNPESPLGCDASVIGEIRVLAADGFYDYESKYFDEDGAALDAPADISPELSERLRELAK
RSFVAVDAEGLVRSDFFVSGDEIYINEVNTMPGFTQISMFPTLWQEGGMSYADLVGRLID
LALERPVGLR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaccgcaagcgcgtcgcgctgatcttcggcggccagtcgtccgagcacggcatc
tcgtgcctgaccgcgtcatcggtgctgaaggcgatcgacaaggaccggttcgaggtcgtc
ggcgtcggcatcacgaagaacggcacctgggagcaggtcccgcttgaggtcatcgagaac
tacgccatcgtcgacggggtcgcgcccgaggtcgaggaggccccacacgaggccgtatgg
atggtcggcgagaacggctgcgaggtggcgacccgcgagggggagacgctggtcgacatc
cacggcgtcgacgtcgccttcgcgctgctgcacgggccctacggtgaggacggcaccatc
cagggactcttcgagatgatgggcatccgctacgtcggcagtggagtcaccgcgtccgcg
atcggcatggacaagcacttcatgaaggtcgccttcgaggccgccgggcttcccgtctac
ccgtacgtcgccgcgagcgcgctgcgcctcgaacaggaccgcgacgccgtcctcgccgaa
atcaacaagctcacctacccgctgttcgtgaagccggcccgcggcggctcgtcgatcggc
atctcgcgggtcagcgacccctccgaactggaggcggccatcgcggaggcccagaagttc
gaccccaagatcgtcgtcgagcagggcctcgtcggcgcccgcgaactcgagtgcgccgtc
ctcggcaaccccgagtccccgctgggctgcgacgcctcggtgatcggtgagatccgcgtc
ctcgcggccgacggcttctacgactacgagtccaagtacttcgacgaggacggcgcggcc
ctcgacgccccggcagacatctcgccagaactctccgagcggctccgtgaactcgcgaag
cgctccttcgtcgcggtcgacgccgagggactcgtccgctccgacttcttcgtctccggc
gacgagatctacatcaacgaggtcaacaccatgccgggcttcacccagatctccatgttc
ccgaccctctggcaggagggtggaatgagctacgccgacctcgtcggacggctcatcgac
ctcgccctcgagcgcccggtggggctgcgctga

DBGET integrated database retrieval system