KEGG   Tessaracoccus flavus: RPIT_00740Help
Entry
RPIT_00740        CDS       T04688                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
tfl  Tessaracoccus flavus
Pathway
tfl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tfl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    RPIT_00740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tfl03400]
    RPIT_00740
Enzymes [BR:tfl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RPIT_00740
DNA repair and recombination proteins [BR:tfl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RPIT_00740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AQP43526
UniProt: A0A1Q2CBN9
LinkDB All DBs
Position
complement(147683..148651)
Genome map
AA seq 322 aa AA seqDB search
MRPMLATPTSTPGQPPTGPGWVHEVKWDGIRAIATIRDGQVRLTNRNEGDISVAYPEVVR
GGAGLPDCTIDGELIALDDQGRPSFHVIAHRMHARNPTRIVRHAAERPVTFVAFDLLELG
GRRLTSLPLTERRSLLETLDLNRPAWQLSDLFDDGDALAAHTREAGLEGILSKRADSPYL
EGVRSPHWVKTPHRSEMIAVIGGWIPETDSPGKLGALWVGHPSDEDTFEANPVLYPVGRV
GSGLGHAQRDVLLQVLKDTERPTPPFDPAPTGPDARRSRWVEPMLCVHVRYLNVTPDGVL
RQPVLLALRPDISPVAAATTVP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgatgctcgccaccccgacgtccacccctggccagccgccgacgggacccggc
tgggtgcacgaggtgaagtgggatgggatcagggcgatcgccaccatccgcgacgggcag
gttcggttgaccaaccgcaacgaaggcgacatctccgtcgcctacccggaggtggtgcgc
ggcggtgcgggactccccgactgcacgatcgacggcgagctcatcgccctcgatgatcag
ggccggccgagcttccacgtcatcgcccaccggatgcacgccaggaacccgacgcggatc
gtccggcacgcagccgaacgccccgtcacgttcgtcgcgttcgacctgctcgagctgggc
gggcggcgcctgacctcgttgccgctcacggagcgacgctccctgctcgaaacgctcgac
ctcaaccgcccagcgtggcagctgtcggatctcttcgacgacggcgacgccctcgccgcg
cacacccgcgaggcggggctggaggggatcctcagcaagcgtgcagactcgccgtacctc
gagggcgtccgcagcccgcactgggtgaagacaccgcaccgctccgagatgatcgcggtg
atcggcggctggatccccgagaccgactcccctggcaagctgggcgcgctatgggtcggc
catccctccgacgaggacaccttcgaggcgaacccggtgctctacccggtggggcgcgtc
ggctccgggctcggccacgcgcagcgcgacgtgctactccaggtgttgaaggacaccgag
cgccccacccccccgttcgacccagccccgaccggccccgacgcgcgccgctcccgctgg
gtggagccgatgctctgcgtccacgtccgctacctcaacgtcacccccgacggcgtcctg
cgccaaccggtgctgctggcactccgcccggacatcagccctgtcgccgctgcgaccacg
gttccctga

DBGET integrated database retrieval system