KEGG   Tessaracoccus flavus: RPIT_05260Help
Entry
RPIT_05260        CDS       T04688                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tfl  Tessaracoccus flavus
Pathway
tfl00010  Glycolysis / Gluconeogenesis
tfl00030  Pentose phosphate pathway
tfl00051  Fructose and mannose metabolism
tfl00052  Galactose metabolism
tfl00680  Methane metabolism
tfl01100  Metabolic pathways
tfl01110  Biosynthesis of secondary metabolites
tfl01120  Microbial metabolism in diverse environments
tfl01130  Biosynthesis of antibiotics
tfl01200  Carbon metabolism
tfl01230  Biosynthesis of amino acids
tfl03018  RNA degradation
Module
tfl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPIT_05260
   00030 Pentose phosphate pathway
    RPIT_05260
   00051 Fructose and mannose metabolism
    RPIT_05260
   00052 Galactose metabolism
    RPIT_05260
  09102 Energy metabolism
   00680 Methane metabolism
    RPIT_05260
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    RPIT_05260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tfl01009]
    RPIT_05260
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tfl03019]
    RPIT_05260
Enzymes [BR:tfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RPIT_05260
Protein phosphatases and associated proteins [BR:tfl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RPIT_05260
Messenger RNA biogenesis [BR:tfl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RPIT_05260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AQP44294
UniProt: A0A1Q2CDU4
LinkDB All DBs
Position
1157097..1159307
Genome map
AA seq 736 aa AA seqDB search
MMARIGVMTSGGDAQGMNAAVRAIVRSGIHSGAEVFAIKEGWAGAIAGQDHIVQLGWSDV
SGILNKGGTVIGTARSLEFMTREGQLQAVANLIANGIDRLIVIGGDGSLTGSRQLCLSWS
DYVEQLLSEGRITSDQAAAHPALHIAGIVGSIDNDMVGTDMTIGTDSALHRITEAIDAIS
STAESHRRTFIIEVMGRRCGYLALMSAIAGGADYTFLPESPPRDGWEERMIDVLARGRAA
GRRDSIIMVAEGAADRSGQPITATTIAQVLRERAGEEARITILGHVQRGGTPSAYDRWMA
TACGVEAVRRVLEAEPGSEPVLVGVHRDAVHTTPLVQAVEDTHRIAGLVADAEYQAAVEA
RGHGFTTMIDVYRMLIEAEPSVRPTPGARRIAIMHAGALAPGMNQLARVAVRSGLDRGYT
MLAVRGGVPGLIAGDVDEVTWSDVEGMANTGGAAFGTRRFVPAESDLYQMARTIEQHNID
ALLVMGGFHAYATVDMMERERRRYQAFDIPIALLPASIDNNLPGWPMAVGADTALNTVVD
SIDMVRMSASASKRAFVVETMGRQCGFLPLVGGIAGGAEKAYLPETGLSLAELSTDVEAL
VDAFESGRTFYLAVMGEEASEHYTSDVVAKLFEAEGRGLYSVRQAVIGHVQQGGTPSPFD
RINATRLAYQAVVNLDGQLKTGRSDYVAASSAAPTLLAPLRTVTDAMDWDNQRPHEQWWL
RLRSVFDQLSRRPGQE
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgatggcacgcatcggagtcatgacctcgggcggagacgcccaggggatgaacgctgcg
gtacgcgcgatcgtgcgtagcggcatccactccggtgccgaggtcttcgcgatcaaggag
ggctgggccggcgccatcgccggccaggatcacatcgtccagctcggatggagcgacgtc
tcgggcatcctcaacaagggcggcaccgtcatcggcaccgcgaggtcgctggagttcatg
acccgtgagggccagctccaggccgttgccaacctcatcgccaacggcatcgaccggctg
atcgtcatcggaggcgacgggtcgctcaccggaagccgccagctctgcctgtcgtggtcc
gactacgtcgagcagctgctctccgagggtcggatcacgagcgatcaggccgcagcgcac
cccgcgctccacattgcgggcatcgtcggctcgatcgacaacgacatggtcggcaccgac
atgacgatcggcaccgactcggcgctccaccggatcaccgaggccatcgacgcgatcagc
tcgaccgcggagtcgcaccgccgcacgttcatcatcgaggtcatgggccgccgctgcggc
tacctagccctcatgagcgccatcgcgggcggcgccgactacaccttcctgccggagtcg
cccccacgcgacggctgggaggagcggatgatcgatgtgctggccaggggccgggccgcc
ggtcgccgcgattccatcatcatggtcgcggagggcgccgccgatcggtccgggcagccc
atcaccgccaccaccatcgcgcaggtgctgcgggaacgcgccggggaggaagcccggatc
acgatcctcggccatgtgcagcgcggtggcaccccgtcggcgtacgaccggtggatggcg
acggcgtgtggtgtcgaggccgtgcgtcgggttctcgaggccgaacccggcagcgagccg
gtgctcgtcggggtgcaccgcgacgccgtccacaccacgcctctcgtgcaggccgtcgag
gacacccaccggatcgccgggctcgttgccgacgccgagtaccaggccgccgtcgaggcc
cgcgggcatggcttcacgacgatgatcgatgtctaccggatgctcatcgaggcggagccg
tcggttcgcccgacgcccggcgcgcgtcggatcgcgatcatgcacgccggggctctggcg
cccgggatgaaccagctggctcgggtggcggtccgatcggggctcgaccgcggctacacg
atgctcgccgtccgtggaggggtccccggcctcatcgccggcgacgtcgacgaggtcacc
tggtccgacgtggagggcatggccaacaccggaggcgcggcgttcggtacgcgacgcttc
gtcccggctgagagcgacctgtaccagatggcgcgcaccattgagcagcacaacatcgac
gccctgctcgtcatggggggcttccacgcctacgcgaccgtggacatgatggagcgcgag
cggcggcgctaccaggcgttcgacatccccatcgccctgttgccggccagcatcgacaac
aacctgcccggctggccgatggcggtcggtgcggacacggcactcaacaccgtcgtggac
tccatcgacatggtgcggatgtcggcctccgcgagcaagcgggcgttcgtcgtcgagacg
atgggccgtcagtgtggcttcctaccactggtcggtggcatcgccgggggtgcggagaag
gcctaccttcccgagactggcctcagcctcgcggagttgtccaccgacgtggaggcgctc
gtcgatgccttcgagagtggccgtaccttctacctcgccgtgatgggcgaggaggcgagc
gagcattacacgtccgatgtggtggcgaagctgttcgaggccgagggccgtgggctgtat
tcggttcgtcaggccgtcatcggacacgtccaacagggcggcactccttcgcccttcgat
cggatcaacgcgacgcggctggcctaccaggcggtcgtcaacctggacggacagctcaag
accggtcgcagcgactacgtggcggcttcgagcgcagcaccgaccctgctggcgccactg
cggaccgtcaccgacgcgatggactgggacaaccaacgcccccacgaacagtggtggctc
cgcctgcgctccgtcttcgaccaactcagccgacgccccggccaggagtaa

DBGET integrated database retrieval system