KEGG   Tessaracoccus flavus: RPIT_05495Help
Entry
RPIT_05495        CDS       T04688                                 

Definition
(GenBank) DNA topoisomerase IV
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
tfl  Tessaracoccus flavus
Brite
KEGG Orthology (KO) [BR:tfl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tfl03032]
    RPIT_05495
   03400 DNA repair and recombination proteins [BR:tfl03400]
    RPIT_05495
Enzymes [BR:tfl01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     RPIT_05495
DNA replication proteins [BR:tfl03032]
 Prokaryotic type
  DNA Topoisomerases
   RPIT_05495
DNA repair and recombination proteins [BR:tfl03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      RPIT_05495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: AQP44335
UniProt: A0A1Q2CE56
LinkDB All DBs
Position
complement(1207815..1210265)
Genome map
AA seq 816 aa AA seqDB search
MAKPTIEDEILEEEHILDVDVTQEMETSFLEYAYSVIYSRALPDARDGLKPVQRRILYAM
DDMGIRPDRGHVKCARVVGQVMGQLHPHGDGAIYDALVRVAQPWSMRLPLIDGHGNFGSL
DAGPAAMRYTECRMATPAVAMTRGLDEDTVDFKANYDGKESEPVVLPAAFPNLLVNGATG
IAVGMATNIAPHNLIEVVAALQQLLKNPAIELDEIMRHLPGPDFPTGGKIVGLDGIRDAY
ATGRGSFKLRSTTRIEKVSPRRMGIVVTELPYMTGPEKIIEQIKKGVDEKKLVGIADVKD
LTDLANGMRLVIEVKNGINPEALLEQLFKVTKLEDTFAINAVALVDGQPRTLTLKEMLEV
YLDHRLEVTLRRSQYQLGKAEDRLHLVRGLITAIADIDDVIAIIRSSDDAAQARERLIGA
FDLDETQANYILDMQLRRLTKYSTIELEKEAGELADTIAGLRSIIDDPTVLRRVVSTELA
AVAKEFGTPRRTILLASSGSPAATATPLEVADNPCLVLLSGTGLVARTDTVADVVPVGRA
AHDVITASVRTTAHGEFGVLTNKGRLLRCRAIELPTVPLTASAPSLQGGSLAQELWPLEP
GERPLGLTSLSPDSLGLALGTRRGVVKRVNAEALSKDAWDVIRLEDGDEVVGATELQSAD
LNLAFITTDGQLLHFPASVVRPQGRSGGGMAGIKLGSGASVLWFGPVNPSTDEVVTISGS
SDSLPGTETGLAKVTPLAEYPPKGRATGGVRAHRFLKGEDALLIAAIGHAPVVAAAGSGS
PVTLPSEFGRRDGSGTPVSQPVAMLAGRGATAAEPQ
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagccgaccatcgaggacgagatcctcgaggaggaacacatcctcgacgtcgac
gtcacccaggagatggagacgagcttcctcgagtacgcctactcggtcatctactcccgc
gcactgcccgacgcccgcgacggactcaaacccgtgcagcgccgcatcctctacgcgatg
gacgacatgggcatccggcccgaccgcgggcacgtcaagtgcgcccgcgtcgtcggccag
gtcatgggccagctccacccccatggcgacggcgcgatctacgacgcgctcgtgcgcgtg
gcccagccatggtcgatgcggctgccgctcatcgacgggcacggcaacttcggctccctc
gacgccggacccgcggccatgcgttacaccgagtgccgcatggccacccccgccgtcgcg
atgacccgcggcctcgacgaggacaccgtcgacttcaaagccaactacgacggcaaggag
tccgagcccgtcgtcctgcccgccgccttcccgaacctcctggtcaacggcgccaccggc
atcgcggtgggcatggccaccaacatcgccccccacaacctcatcgaagtcgtcgccgcc
ctgcagcagctgctgaagaaccccgccatcgagctcgacgagatcatgcgccatctcccc
ggaccggacttccccaccggcggcaagatcgtcggtctcgacggcatccgcgacgcctac
gccaccggtcggggctccttcaagctccgctccaccacgcgcatcgagaaggtgtcgccg
cggcggatgggcatcgtggtcaccgaactgccctacatgaccggccccgagaagatcatc
gagcagatcaagaagggagtcgacgagaagaagctcgtcggcatcgccgacgtcaaggac
ctcaccgatctcgccaacggcatgcggctggtcatcgaggtcaagaacgggatcaacccc
gaagccctcctcgagcagctgttcaaggtgaccaagctcgaggacaccttcgcgatcaac
gccgtcgctctggtcgacggccagccgcgcaccctgacgctcaaggagatgctcgaggtc
tatctcgaccaccgcctcgaggtcaccctgcgccgcagccaataccaactcggtaaggcc
gaagaccgcctccacctcgtgcgcggcctcatcaccgcgatcgccgacatcgacgacgtc
atcgcgatcatccgcagctccgacgacgccgcccaggcccgtgaacgcctcatcggagcg
ttcgacctcgacgagacccaggccaactacatcctcgacatgcagctgcgccggctcacg
aagtactccaccatcgaactggagaaggaagcaggcgagctcgccgacaccatcgcgggc
ctccgcagcatcatcgacgatcccaccgtcctgcgccgcgtcgtcagcaccgaactcgca
gccgtggcgaaggagttcggcacccctcggcgcaccatcctgctggcctcctcgggcagc
cccgccgcgacggcaacgccactcgaagtggccgacaacccctgcctcgtgctgctgagc
ggcaccgggctggtggcccggaccgatacggtagctgacgtcgtgccggtgggcagggcc
gcccacgatgtcatcaccgcctcggtgcgcaccactgcccacggcgagttcggcgtcctc
accaacaaggggcgactgctgaggtgccgcgccatcgagctgcctaccgtgccactgacc
gcctcggcaccgagcctgcagggagggtcgctcgcgcaggagctgtggcccctcgaaccg
ggcgagcgtcccctggggctgaccagcctctccccagattcgctgggtctggcgctcggc
acccgacgcggcgtggtcaagcgcgtcaacgcggaagcgttgtcgaaggacgcctgggat
gtcatccggctcgaggacggcgacgaggtggtgggtgccaccgaactgcagtcggccgac
ctcaacctggcattcatcaccaccgacgggcaactgctgcacttccccgcctccgtggtg
cggccgcagggcaggagcggcggcggaatggcgggcatcaagcttggcagcggggcgtcc
gtcctgtggttcggaccggtcaacccctccaccgacgaggtcgtcacgatctccgggtcc
tccgattcccttccgggaaccgagacagggctggccaaggtgacgccgctcgcggagtac
ccaccgaagggcagggccaccggcggagttcgcgcccaccgcttcctcaagggtgaagac
gccctcctcatcgccgccatcggccacgcgcccgtcgtcgccgcggccggcagcggttcg
cccgtcactctcccatcggagttcggacgtcgcgacggctccggcacgccggtgtctcag
cccgtggcgatgctggcgggacgcggcgccacagcggccgaaccacagtag

DBGET integrated database retrieval system