KEGG   Tessaracoccus flavus: RPIT_08570Help
Entry
RPIT_08570        CDS       T04688                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
tfl  Tessaracoccus flavus
Pathway
tfl00020  Citrate cycle (TCA cycle)
tfl00190  Oxidative phosphorylation
tfl00650  Butanoate metabolism
tfl01100  Metabolic pathways
tfl01110  Biosynthesis of secondary metabolites
tfl01120  Microbial metabolism in diverse environments
tfl01130  Biosynthesis of antibiotics
tfl01200  Carbon metabolism
Module
tfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPIT_08570
   00650 Butanoate metabolism
    RPIT_08570
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RPIT_08570
Enzymes [BR:tfl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RPIT_08570
    1.3.5.4  fumarate reductase (quinol)
     RPIT_08570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_6 Fer4 Fer4_2 Fer4_15 Fer4_4 Fer2 Fer4_16 Fer4_21 Fer4_22 Fer4_13 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AQP44837
UniProt: A0A1Q2CFH0
LinkDB All DBs
Position
complement(1839420..1840181)
Genome map
AA seq 253 aa AA seqDB search
MKLKLRIWRQAGANAAGRMVEYDLDGVSEDMSFLEMLDLLNENLTNRNEEPVAFDHDCRE
GICGMCGVVINGVAHGAPEGVRTTTCQLHMRSFQDGATIDIEPWRAGSFPVIKDLAVDRT
AFDRIIQAGGFISSNTGSAPDAHATPAPKREADVAFDNATCIGCGACVAACPNSSAMLFT
AAKITHLAMLPQGQPERYRRVKSMVAQHDEEGFGNCTNIGECAAVCPKGIPLESISQLNR
DLVKSLFKADGKI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcaagctacgtatctggcgtcaggccggcgccaacgccgctggccggatggtc
gagtacgaccttgacggtgtgtcggaagacatgtcgttcttggagatgcttgaccttctc
aacgagaacctcaccaaccgcaacgaggaacccgtcgccttcgaccacgactgccgtgag
ggcatctgtggcatgtgtggcgtggtcatcaacggcgtagcccacggcgcgccggagggt
gtccgcaccaccacctgccagctgcacatgcgttcgttccaggacggcgcgacgatcgac
atcgagccgtggcgtgcaggttccttccccgtgatcaaggaccttgccgtcgaccgcacc
gcgttcgaccggatcatccaggcgggcggcttcatttcctcgaacaccggttcggctccg
gacgctcacgcgaccccggccccgaagcgcgaggcggacgtcgccttcgacaacgccacc
tgcatcggttgcggcgcctgcgtcgcggcctgcccgaacagctccgccatgctgttcacg
gcggcgaagatcacccacctggcgatgctgccgcagggccagccggagcgctaccgtcgc
gtgaagtccatggtggcgcagcacgacgaagagggcttcggcaactgcaccaacatcggt
gagtgcgcagcagtgtgccccaagggcatcccgttggagtccatctcgcagctgaaccgc
gacctggtgaagtcgctgttcaaggctgacggcaagatctga

DBGET integrated database retrieval system