KEGG   Tessaracoccus flavus: RPIT_08575Help
Entry
RPIT_08575        CDS       T04688                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
tfl  Tessaracoccus flavus
Pathway
tfl00020  Citrate cycle (TCA cycle)
tfl00190  Oxidative phosphorylation
tfl00650  Butanoate metabolism
tfl01100  Metabolic pathways
tfl01110  Biosynthesis of secondary metabolites
tfl01120  Microbial metabolism in diverse environments
tfl01130  Biosynthesis of antibiotics
tfl01200  Carbon metabolism
Module
tfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPIT_08575 (sdhA)
   00650 Butanoate metabolism
    RPIT_08575 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RPIT_08575 (sdhA)
Enzymes [BR:tfl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RPIT_08575 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     RPIT_08575 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AQP44838
UniProt: A0A1Q2CFF1
LinkDB All DBs
Position
complement(1840178..1842193)
Genome map
AA seq 671 aa AA seqDB search
MTDTITPAVTTATDYWVDGHDIADTKAPQVDIDKMWQTRQFQARLVNPANRRKLSVIIVG
TGLAGGAAAATLGEAGYNVLNFCYQDSPRRAHSIAAQGGINAAKNYRNDNDSTHRLFYDT
VKGGDYRARETNVYRLAEVSANIIDQCVAQGVPFAREYGGLLDTRSFGGVQVQRTFYARG
QTGQQLLIGVYQQLERQIAAGTVKMYARHEMVELIVVDGRARGIVTRNMINGKVETWMAD
AVVLATGGYGNVFFLSTNAMGCNVTATWRAHRKGAYFGNPCYTQIHPTCIPVHGDTQSKL
TLMSESLRNDGRIWVPKRAEDCVKDPRQIAEQDRDYYLERIYPSFGNLVPRDIASRQAKN
MCDEGRGVGPAVTEIGPDGVERQVRRGVYLDFSDAIHRMGQKTVEAKYGNLFDMYQQITG
ENPYEVPMRIYPAVHYTMGGLWVDYDLQSSITGLYVTGEANFSDHGANRLGASALMQGLS
DGYFVLPNTINDYLADAPFEKIADDHPAVVEARDSAQARIDKLLSIQGTRSVDSYHKELG
NIMWEYCGMYRTEEGLTKAIGLIRDLKADFWTNVRVTGVNEDFNQALERAGRVADFFELG
ELMCIDALHRRESCGGHFRGESQTEEGEALRHDDEYLYVGAWEWGGEGGKPVLHREPLIY
KAIELKQRSYK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacaccatcacccccgcagtgaccacggccaccgactactgggtcgacggtcac
gacatcgccgataccaaggcgccccaggtcgacatcgacaagatgtggcagacgcgccag
ttccaggctcgcctggtcaacccggccaaccgccgcaagctgagcgtcatcatcgtcggc
accggcctcgccggtggcgccgctgctgccacgttgggcgaagccggctacaacgtgctc
aacttctgttaccaggactcgccacggcgggcccactcgatcgcagcgcagggcggcatc
aacgccgccaagaactaccgcaacgacaacgactcgacgcaccggttgttctacgacact
gtcaagggcggcgactaccgcgcacgtgagacgaacgtctaccgactggccgaggtctcg
gccaacatcatcgaccagtgcgtcgcccagggcgtcccgttcgcccgcgagtacgggggt
ctcctcgacacccgctcgttcggcggcgtgcaggtgcagcgcaccttctacgcccgcggg
cagacgggtcagcagctgctgatcggcgtctaccagcagctcgagcggcagatcgcggcc
ggcaccgtcaagatgtacgcgcgccacgagatggtggagctcatcgtcgtcgacggtcgt
gcccgcggcatcgtgacccgcaacatgatcaacggcaaggtcgagacctggatggccgac
gcggtcgtgctggccaccggcggatacggcaacgtgttcttcctgtcgaccaacgccatg
ggctgcaacgtcaccgccacgtggcgtgcgcaccgcaagggtgcctacttcggcaacccc
tgctacacgcagatccacccgacctgcatcccggtgcacggcgacacccagtcgaagctc
acgctgatgtcggagtcgttgcgcaacgacggccggatctgggtgccgaagcgcgctgag
gactgcgtcaaggatccccgtcagatcgccgagcaggaccgcgactactacctggagcgg
atctacccgtcgttcggcaacctggtgccccgcgacatcgcgtcgcgccaggcgaagaac
atgtgcgacgagggtcgcggtgtcggccccgccgtcaccgagatcggtcccgacggcgtc
gagcgtcaggttcgccgcggcgtctacctggacttctccgatgccatccaccgcatgggc
cagaagaccgtcgaggccaagtacggcaacctcttcgacatgtaccagcagatcaccggt
gagaacccgtacgaggtgccgatgcgcatctacccggcggtgcactacaccatgggcggt
ctctgggtcgactacgacctgcagtcgtcgatcaccggtctctacgtgaccggtgaggcc
aacttctccgaccacggcgccaaccgcctgggtgcctcggcgctcatgcagggactttcc
gacggctacttcgtgttgcccaacacgatcaacgactacctggcggacgccccgttcgag
aagatcgccgacgaccatccggccgtcgtcgaggctcgcgactcggcccaggccaggatc
gacaagctgctgagcatccaggggacccgctccgtcgactcctaccacaaggaactcggc
aacatcatgtgggagtactgcgggatgtaccgcacagaggagggccttaccaaggccatc
ggcctcatccgtgacctcaaggcggatttctggaccaacgtccgggtcacgggtgtgaac
gaggacttcaaccaggcgctcgagcgggctggccgcgtggccgacttcttcgagctgggt
gagttgatgtgcatcgacgctctccaccgccgcgagtcctgcggtggacacttccgcgga
gagtcccagaccgaggaaggcgaggccctgcgccacgacgacgagtacctctacgtcggc
gcctgggagtggggcggcgagggcggcaagcccgtgctgcaccgcgagcctctcatctac
aaggcaatcgaactgaagcaacggagttacaagtga

DBGET integrated database retrieval system