KEGG   Tessaracoccus flavus: RPIT_11310Help
Entry
RPIT_11310        CDS       T04688                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07776  two-component system, OmpR family, response regulator RegX3
Organism
tfl  Tessaracoccus flavus
Pathway
tfl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tfl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RPIT_11310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tfl02022]
    RPIT_11310
Two-component system [BR:tfl02022]
 OmpR family
  SenX3-RegX3 (phosphate starvation response)
   RPIT_11310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AQP45310
UniProt: A0A1Q2CGY0
LinkDB All DBs
Position
complement(2412836..2413513)
Genome map
AA seq 225 aa AA seqDB search
MTRILIIEDEDSYRDATSFMLRKEGFEVATAADGAEGLAEYDRSGADLVLLDLMMPGMSG
VEVCRQLRSRGNVAIVMVTARDSEVDKVVGLEIGADDYVTKPFSHRELVARIRAVLRRGQ
DQVLLPEVVEADGVRVDVERHQVTVDGVEVRFALREFELLELLLRNAGRVMTRGQLIDRI
WGSDYVGDTKTLDVHIKRLRSKIEKDPANPQRLITVRGLGYKYEG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcatcctgatcatcgaggacgaggactcctaccgcgacgccaccagcttcatg
ctgcgcaaggaggggttcgaggtcgccaccgcggccgacggcgccgagggactcgccgag
tacgaccgttcgggcgcggacctcgtcctgctcgacctcatgatgccgggcatgtcgggc
gtcgaggtgtgccggcagctccggtcgcgggggaacgtcgcgatcgtcatggtgacggcg
cgggactcggaagtggacaaggtggtgggtctggagatcggtgccgacgactacgtcacg
aagccgttcagccaccgggagctggttgcccgcatccgggcggtgctgcgtcggggccag
gaccaggtgctgctgcccgaggtggttgaggcagacggcgtgcgcgtcgacgtggagcgc
caccaggtgaccgtcgacggggtggaggtgcgcttcgcgctacgcgaattcgagctgctc
gagctgctgctgcgcaacgccggccgggtgatgacccgcggccagctgatcgaccggatc
tggggcagcgactatgtgggcgacacgaagacgctcgacgtccacatcaagcggctccgc
agcaagatcgaaaaggaccctgccaacccgcagcggctgatcaccgtgcgggggctcggc
tacaagtacgaggggtga

DBGET integrated database retrieval system