KEGG   Tannerella forsythia: BFO_0169Help
Entry
BFO_0169          CDS       T01682                                 

Definition
(GenBank) glycosyl hydrolase, family 57
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
tfo  Tannerella forsythia
Pathway
tfo00500  Starch and sucrose metabolism
tfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BFO_0169
Enzymes [BR:tfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BFO_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 Vac_Fusion
Motif
Other DBs
NCBI-ProteinID: AEW20580
UniProt: G8UIB6
LinkDB All DBs
Position
complement(196781..198130)
Genome map
AA seq 449 aa AA seqDB search
MEKIKTTEDMKTICFYFQIHQPFRLRRYRFFDIGNNHYYYDDFQNEEIFRRISEKCYLPA
NRTIMEMIRKSGGKFKVAFSISGTALEQMEIYAPEVIDSFRELAQLGCVEFLAETYAHSL
SSLGDAEEFRAQVKMHKEKIQSLFGVRPKVFRNTELIYSDDISELVYNLGFEGMLTEGAK
HVLGWKSPNYVYASAVRPQLKLLLKNDRFSEDLSLRFNDYTWKEYPLTADKYISAIASTA
EPEKVINAFMNYEVLGSMHAADTGIFEFFKALPQYAERNNLSFSLPSEVFENMKPVDVVS
VPYPMSWVDEEKDCSSWLGNVLQHEAFQKINEIGERVRLSGNRRIKQDWIYLQSSDHFYY
MNTKHYNLFSPYDNPYDAFNNYMNVLSDFMLRVEAEFPSSIENEELNSLLTTIRNQANEI
NRLEKKLETIQKSSETKKKSAVTKKVAGK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaattaaaacaacagaagatatgaaaacaatttgcttttactttcaaatccat
cagccttttcgtttgagaaggtatcgttttttcgacatcggaaacaatcattattattat
gacgatttccaaaatgaggaaatctttcgtcggatttccgaaaagtgttacttgccggct
aaccgtaccatcatggaaatgatacgtaagagcggcggtaagtttaaagtggccttttcg
atctcggggacagcgcttgaacagatggaaatttatgcgcccgaagtgatcgacagcttt
cgcgaactcgcacagctcggttgtgtggagtttctggccgaaacgtatgcccactcgctc
tcctcgctcggcgatgctgaggagttcagggcacaagtcaagatgcataaggagaaaata
cagtcgctctttggcgttcgtcccaaagtgttccggaatacggaactgatttattcggat
gatatctccgaactcgtctataacctcggcttcgaaggcatgctgaccgaaggagccaag
catgtattgggatggaaaagtccgaactacgtctatgcgtcggctgttcgtccgcagctg
aaattgctgctgaagaacgaccgtttcagtgaagacctctcgctccgcttcaacgattat
acatggaaagaatacccgctgacagccgataaatatatctcggcgattgcttcgacggcc
gagccggaaaaggtgatcaacgcctttatgaactacgaagtactgggctccatgcatgcg
gccgacacgggaatcttcgagttcttcaaggcgttaccgcagtacgccgaaagaaataac
ctctcgttctcactgccctccgaagtgtttgaaaacatgaaaccggtcgatgtggtttcc
gtcccctatccgatgtcatgggtcgatgaagaaaaagactgcagttcgtggttaggtaat
gtattgcagcatgaagcgttccagaaaatcaacgaaatcggagaacgggtgcgcctgtcg
ggtaatcgtcgcatcaagcaggattggatctatttgcagagcagcgaccacttttattac
atgaacacgaagcattataacctgttcagtccgtatgataatccgtacgatgcgttcaat
aactacatgaacgtactttccgatttcatgctgcgtgtcgaagcggagttcccctcttcg
atcgaaaacgaggagctgaactcgttgctcacgaccatccgcaatcaggcgaatgaaatt
aaccggcttgagaaaaagctggaaacgattcagaaatcatcggaaacgaagaagaaaagc
gccgtcaccaagaaagttgccggtaaataa

DBGET integrated database retrieval system