KEGG   Tannerella forsythia: BFO_1008Help
Entry
BFO_1008          CDS       T01682                                 

Definition
(GenBank) THUMP domain protein
  KO
K07444  putative N6-adenine-specific DNA methylase [EC:2.1.1.-]
Organism
tfo  Tannerella forsythia
Brite
KEGG Orthology (KO) [BR:tfo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BFO_1008
Enzymes [BR:tfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     BFO_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 THUMP N6_Mtase
Motif
Other DBs
NCBI-ProteinID: AEW20787
UniProt: G8UQL0
LinkDB All DBs
Position
complement(1094380..1095717)
Genome map
AA seq 445 aa AA seqDB search
MTDGSFEMIAKTLYGLEDILAEELTALGAGNVKTGRRMVSFTGDKAMLYKANFHCRTALR
ILMPIARFRANNADMVYQEVKRIEWEKYLSPEKTFSVDAVIYSEDFHHSKFVAYRTKDAI
ADYFSERVGDRPSVRLSNPDLYINIHISHKDCTLSIDSSGESLHKRGYRTAQGEAPLNEV
LAAGMILETGWRGESHFVDPMCGSGTLLIEAAMIALNIAPGIYRKGFAFERWPDFDRDLF
DEIYNDDSSEREFSFKCYGSDISPLTVKKAEKNIRSAGLTKYIELQTLPFQQFTEAPRPG
ILITNPPYGERITPNNISELYSMIGERLKHVFTGYGAWILSYKDECFDRIGLRPKHKIKL
RNGDLECEYRCYELFAGTNKAYKKAEGERKKAAPRVIAEKQNRKEMASSNYRKGKTDRKR
PSGSYPKSYRNVSIVKTEKRHQPKT
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacggacggctcattcgagatgatcgccaagacgctctacgggttagaagatatcttg
gctgaagaattaacggcgctcggcgccggaaacgtaaagacggggcgacgcatggtatcg
ttcacgggcgataaagccatgctctacaaggcaaactttcattgccgtacggcgttgcgt
attctgatgccgatcgcccggtttcgtgcgaacaatgccgatatggtatatcaggaagtg
aaacggatcgaatgggagaaatatctctctcccgagaaaacattttcagtcgatgccgta
atctattccgaagacttccaccactccaaatttgtggcctaccgcaccaaagacgcgatt
gccgactacttcagcgagcgcgtgggcgatcgcccgtcggtgcgtttgagcaaccccgac
ctgtatatcaacattcatatctcacacaaagactgcacgctgtctatcgacagttcgggc
gagagccttcacaagcgcggttatcgaacggcacagggtgaggctcctctcaatgaagtg
cttgccgccggcatgatcctggaaacaggatggcggggcgagtcgcatttcgtcgatccc
atgtgtggatcgggcaccctgctgatcgaagcagccatgatcgccctgaacatcgccccg
ggcatctaccgcaagggctttgccttcgaacgatggcccgacttcgaccgcgacctgttc
gacgagatatacaacgacgactcctccgaacgcgaattttcgttcaaatgttacgggtcg
gacatctcgccgttaaccgtcaagaaagccgaaaagaatatccgaagcgcaggcctgacg
aaatacatcgaattgcaaacgctgccttttcagcaattcaccgaagcgccgcgaccgggt
atcctcattacgaatccgccttatggcgaacgcatcacgcccaataacatcagcgaattg
tacagtatgatcggcgaacggctgaagcacgtattcaccggatacggcgcatggatactc
agctacaaagacgagtgtttcgatcgcatcggattacgtccgaagcataaaatcaagctt
aggaatggcgacctcgaatgcgagtaccgatgctacgagctgtttgccggaacgaataaa
gcctacaagaaagctgagggcgaaagaaaaaaagcagcccctcgggtaatcgccgaaaag
caaaaccgaaaggaaatggcttcgagcaattaccggaaaggaaaaacagaccggaaacgg
ccttcgggcagttacccgaaaagctaccgaaatgtatcgatcgtaaaaaccgaaaagaga
catcagccaaaaacctga

DBGET integrated database retrieval system