KEGG   Tannerella forsythia: BFO_1926Help
Entry
BFO_1926          CDS       T01682                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase (Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tfo  Tannerella forsythia
Brite
Enzymes [BR:tfo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BFO_1926 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N GSCFA
Motif
Other DBs
NCBI-ProteinID: AEW21164
UniProt: G8UPN5
LinkDB All DBs
Position
complement(2052676..2053260)
Genome map
AA seq 194 aa AA seqDB search
MSFETPKLPYAQNALEPVISQQTIEYHYGKHLQNYVNTLNKLIVGTEYEGKSIVEIVKTA
PDGAIFNNAGQALNHELYFLQFKPQTEHNAPKGKLAEAINRDFGSFEAFQKKFTEASLTL
FGSGWAFLSIDKEGKLVITQEANGSNPVRRGYTPIFGIDVWEHAYYLDYQNRRADHIEAV
WSIIDWEVVESRMK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgaaacaccaaagcttccctatgcacagaatgcattggaacctgtaatcagc
cagcagacaattgaatatcattatggtaaacatttacagaactatgtaaatacattgaac
aaacttatagtaggtacggaatacgaaggaaaaagcattgtggagattgttaaaacagcc
cccgacggtgctattttcaacaatgccggtcaagcgctgaatcatgaactttacttcctg
caattcaagcctcagacagagcataacgctcctaagggcaaacttgccgaagccatcaat
cgcgatttcggtagcttcgaggctttccaaaagaagtttacggaggcatccttaaccttg
ttcggatcgggatgggctttcttatccatcgataaagaaggtaaattagtgatcacacag
gaagccaacggctccaatccggtacggagaggatacactccgatcttcggtatcgacgtg
tgggaacacgcttactatctggattaccagaacagacgtgccgaccatatcgaagcggta
tggagcatcatcgactgggaagtggtagagagcagaatgaaataa

DBGET integrated database retrieval system