KEGG   Tannerella forsythia: BFO_2272Help
Entry
BFO_2272          CDS       T01682                                 

Definition
(GenBank) hypothetical protein
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
tfo  Tannerella forsythia
Pathway
tfo00500  Starch and sucrose metabolism
tfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BFO_2272
Enzymes [BR:tfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BFO_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C HipA_C
Motif
Other DBs
NCBI-ProteinID: AEW20125
UniProt: G8UJE0
LinkDB All DBs
Position
complement(2431856..2433982)
Genome map
AA seq 708 aa AA seqDB search
MKSINLRKKLFFLFSFLVSAPFTMRAEELKSPDGNLLMRFEVNGEGTPVYELTYKRKPVI
KPSRLGLEIEGFSLRKAFTLKGVETVTFDETWTPVWGEVKAIRNHYNEMTATLHQADGDR
TMVIRFRLYDDGLGFRYEFPQQKSLNYFVIKEEYSEFAMAGDHKAFWIPGDYDTQEYDYT
ESRLTEIRGLMQTAITPNTSQTPFSPTGVQTALMMKSDDGLYINLHEAALVDYPCMSLNL
DDQTLTFQSWLTPDAQGKKGYMQTPCHTPWRTVIVSDDARRILASHLTLNLNEPCKLDDV
SWIRPVKYIGVWWEMISGKSTWAYTNDLPSVHLDVTDYTKMKPNGTHAANNEKVRRYIDF
AAKHGFDQVLVEGWNIGWEDWFGNSKDYVFDFVTPYPDFDLKALNEYAHSKGVKLMMHHE
TSSSVRNYERQMEKAYKLMNDYGYNAVKSGYVGNIIPRGEYHYGQWMVNHYLYAVKKAAE
HRIMVNAHEAVRPTGLCRTYPNLIGNEAARGGEYESFGGNKVFHTTILPFTRLMGGPMDY
TPGIFETRLEKVNPGNNSYVHSTLARQLALYVTMYSPLQMAADLPENYERFMDAFQFIKD
VAIDWDDSKYLEAEPGRYITVARKAKGTNNWFVGCTANEDGHLSNVSLDFLDPGRKYTAT
IYADAPTAHYEKNPQAYTIKQMKVTNKSKLTLRAASGGGYAISIMEQK
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcataaatctacgaaaaaagctgttttttctattctcttttcttgtgtccgca
ccttttacgatgcgtgcggaagagttgaaatcgccggacggaaacctgttgatgcgtttc
gaggtgaacggcgaaggtacccctgtttacgaattgacgtacaaacggaagccggtgatc
aaaccgagcaggctcggtctcgaaatcgaaggattctcgttgcgtaaagcgtttacgctg
aaaggtgtcgaaaccgtaacgttcgacgagacctggacgcctgtctggggcgaagtgaaa
gcgatacgcaatcattataacgagatgaccgcgacgcttcatcaggccgacggcgaccgc
accatggtcatacgtttccgcctttatgacgacggactgggctttcggtacgaatttccg
caacagaagagcctgaactattttgttattaaggaagaatattcggagtttgcgatggcg
ggcgatcataaagccttctggatcccgggcgattacgatacgcaggaatacgactacacg
gaatcgcgcttgacggagatacgcggactgatgcaaacggccatcacgccgaacacgtcg
caaacgccattttcacctacgggcgtgcagacggcgctgatgatgaagtccgatgacggg
ctttacatcaacttgcatgaggctgctcttgtcgactacccgtgcatgtcgctcaatctc
gacgatcaaacgttgacgtttcagtcgtggctgacgccggatgcgcaagggaaaaaagga
tatatgcaaaccccgtgtcacacgccgtggcgtacagtgatcgtcagcgacgacgcacgc
cgtatcctcgcctctcatctgacgctgaatctgaacgaaccgtgcaagctcgacgatgtg
tcgtggattcgtccggtgaaatacatcggggtatggtgggaaatgatttcggggaaatcc
acgtgggcttataccaacgacttgccgtcggtgcacctcgacgtcacggactatacgaaa
atgaagccgaacggcacgcatgcggccaacaacgaaaaggtgcgccgctacatcgacttt
gccgcgaagcacggcttcgatcaggtactggtcgaaggctggaacatcggttgggaggac
tggttcgggaactcgaaggattacgtcttcgacttcgttacgccttatcccgacttcgac
ctcaaggcgctcaacgaatatgcgcactcgaagggcgtgaagctgatgatgcaccacgag
acgtcatcctccgtgcgaaactacgaacgccagatggagaaggcctataagttaatgaac
gactatggctacaacgccgtcaaaagcggttatgtgggcaatatcatcccccgcggcgaa
taccattacgggcaatggatggtgaaccattatttatatgcggtcaaaaaagcggccgaa
caccggatcatggtcaacgcacacgaagcggtgcgcccgacggggctttgccggacgtat
ccgaacctgatcggtaacgaggcggcccgcggcggggaatatgaatcgttcggcggcaac
aaggtcttccatacaaccatcctccccttcacacgactgatgggcggcccgatggactat
acgcccggcatctttgaaacacggctcgagaaagtgaacccgggcaacaattcatacgta
cattcgaccctcgcacggcagttggcgctgtatgtgacgatgtacagcccgctgcagatg
gcggccgacctgccggagaactacgaacgctttatggacgcgttccagttcatcaaagac
gtggccatcgactgggacgactcgaaatacttggaagctgagccggggcgctacatcacc
gtggcgcgcaaggccaagggcacaaacaactggttcgtaggctgcacggccaacgaggac
ggacatctgtcgaatgtctcgctcgacttcctcgacccggggcgcaagtacacggccacg
atctatgccgacgccccgacggcgcactacgaaaagaatccgcaggcgtacaccatcaag
cagatgaaggtgaccaacaagtcgaagctaacgctccgcgcggcatcgggcggaggatat
gccatcagtatcatggaacagaaataa

DBGET integrated database retrieval system