KEGG   Thermobifida fusca: Tfu_0092Help
Entry
Tfu_0092          CDS       T00265                                 

Definition
(GenBank) malate dehydrogenase (NAD)
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
tfu  Thermobifida fusca
Pathway
tfu00020  Citrate cycle (TCA cycle)
tfu00270  Cysteine and methionine metabolism
tfu00620  Pyruvate metabolism
tfu00630  Glyoxylate and dicarboxylate metabolism
tfu00680  Methane metabolism
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01120  Microbial metabolism in diverse environments
tfu01130  Biosynthesis of antibiotics
tfu01200  Carbon metabolism
Module
tfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tfu_M00012  Glyoxylate cycle
tfu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tfu_0092
   00620 Pyruvate metabolism
    Tfu_0092
   00630 Glyoxylate and dicarboxylate metabolism
    Tfu_0092
  Energy metabolism
   00680 Methane metabolism
    Tfu_0092
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Tfu_0092
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Tfu_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AAZ54130
UniProt: Q47TT4
LinkDB All DBs
Position
113933..114925
Genome map
AA seq 330 aa AA seqDB search
MAKAPVNVTVTGAAGQIGYALLFRIASGQLLGVDTPVRLRLLEIPQAIKAAEGTAMELDD
CAFPLLAGVDIYDDPRKAFDGVNVALLVGARPRTKGMERRDLLEANGGIFGPQGAAINDG
AADDVRVLVVGNPANTNALIAQAHAPDIPADRFTAMTRLDHNRALSQLAAKLNVSVSDIK
KLTIWGNHSATQYPDIFHAEVNGRSAVEAVNDEEWLRDTFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVYDWVNGTPEGDWTSVALPSDGSYGVPEGLVSSFPVVSRNGSWEIVQGLE
INEFSRERIDASVRELEEEREAVRALGLIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggctccagtcaacgtcaccgtcaccggcgctgccggacagatcggctacgca
ctgctgttccggatcgcctcgggccagctcctcggcgtagacacgcccgttcggctccgc
ctgctggagatcccgcaggcgatcaaggcggccgagggtaccgcgatggagcttgacgac
tgcgcgttcccgctgctcgccggggtcgacatctacgacgacccccgcaaggcgttcgac
ggcgtgaacgtggccctgctggtcggcgcccggccgcgcacgaaggggatggagcgccgc
gacctgctggaagccaacggcggcatcttcggtccccagggtgcggccatcaacgacggt
gccgctgacgacgtgcgcgtcctcgtcgtgggcaaccccgcgaacacgaacgcgctgatt
gcgcaggcgcacgccccggacatcccggcggaccggttcaccgcgatgacccggctcgac
cacaaccgggcgctgtcccagctcgccgccaagctgaacgtgtcggtgagcgacatcaag
aagctgacgatctggggtaaccactccgcgacccagtacccggacatcttccacgccgag
gtcaacggccgcagcgcggtggaggccgtcaacgacgaggagtggctgcgcgacacgttc
atcccgaccgtggccaagcgtggtgcggcgatcatcgaggcccgcggcgcttcctcggct
gcgtccgcggcgaacgctgcgatcgaccacgtctacgactgggtgaacggtaccccggag
ggcgactggacgtcggtggcgctgccgtccgacggctcctacggcgtgccggagggcctg
gtgtcgtcgttccccgtggtgtcccggaacggctcctgggagatcgtccagggcttggag
atcaacgagttctcccgcgagcggatcgacgcgtcggtgcgcgagctggaggaggagcgg
gaagccgtccgcgctctgggtctgatcaagtag

DBGET integrated database retrieval system