KEGG   Thermobifida fusca: Tfu_0175Help
Entry
Tfu_0175          CDS       T00265                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
tfu  Thermobifida fusca
Pathway
tfu00340  Histidine metabolism
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01230  Biosynthesis of amino acids
Module
tfu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Tfu_0175
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Tfu_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AAZ54213
UniProt: Q47TK1
LinkDB All DBs
Position
complement(199004..199267)
Genome map
AA seq 87 aa AA seqDB search
MKTFEELFTELSEKARTRPAGSRTVAQLDAGVHAIGKKVVEEAAEVWMAAEYQSDEETAE
EISQLLYHVQVLMLARGLRLEDVYRHL
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcgaagagctgttcaccgagctgtccgagaaggcgcggacccgcccggca
ggatcgaggacggtcgcccaactggacgccggggtgcatgcgatcggcaagaaggtcgtc
gaggaagcggctgaagtctggatggccgccgaataccagagcgacgaagaaaccgccgaa
gagatctcccagctcctctaccacgtccaagttctgatgctggcgcgcggcctccgtctg
gaagacgtctaccggcatctctag

DBGET integrated database retrieval system