KEGG   Thermobifida fusca: Tfu_0853
Entry
Tfu_0853          CDS       T00265                                 

Definition
(GenBank) Undecaprenyl pyrophosphate synthetase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
tfu  Thermobifida fusca
Pathway
tfu00900  Terpenoid backbone biosynthesis
tfu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tfu_0853
Enzymes [BR:tfu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     Tfu_0853
SSDB
Motif
Pfam: Prenyltransf Terminase_4
Other DBs
NCBI-ProteinID: AAZ54891
UniProt: Q47RM6
LinkDB
Position
1007744..1008592
AA seq 282 aa
MSPKTVFSTDTHREPIPPQPHPSGARPPQLPRELIPRHVAIVMDGNGRWAKQRGLPRTEG
HKAGESSLFDVIEGALELGVPYLSAYAFSTENWKRSPDEVRFLMGFNRDVIRRRRDELHA
RGVRVRWAGRPGRLWKSVIKELTEAEELTKHNTKLTLQFCVNYGGRAEIADAAAALARDV
AAGRLSPNRVTEATLARYLYHPDIPDVDLFIRSSGEQRLSNFLLWQSSYAEFVFLDTLWP
DFDRRHFWQACEIYARRDRRYGGAEPNPVGPPQSAAGAQGQD
NT seq 849 nt   +upstreamnt  +downstreamnt
gtgagtcccaagaccgtcttctcgaccgacacccaccgggagccgatacccccgcaaccg
caccccagcggggctcggccaccccagttaccccgagaactcattccccggcacgtggca
atcgtcatggacggcaacggccgctgggccaagcagcgcggcctgccccgtactgaaggg
cacaaggcgggcgagtcctccctgttcgacgtgatcgagggagcgctggagctcggcgtg
ccctacctgtccgcctacgcgttctccacggagaactggaagcgctccccggacgaggtg
cgcttcctcatggggttcaaccgcgacgtgatccgacgccgccgtgacgagctgcacgca
cgcggggtgcgggtgcgctgggcgggacggccgggacggctgtggaagagcgtcatcaaa
gagctcaccgaagccgaagagctgaccaagcacaacaccaagctcacgctgcagttctgc
gtgaactacgggggccgtgccgagatcgcggacgcggccgcggccctggcccgggatgtg
gctgccggccgcctctcccccaaccgggtcaccgaggccacgctcgctcgctacctgtac
cacccggacatccccgacgtggacctgttcatccgttcctccggggagcagcgcctctcc
aatttcctgctctggcagtcgtcgtacgcggaattcgtgttcctcgacacgctctggccc
gacttcgaccggcggcacttctggcaggcctgcgagatctacgcccgccgggaccgtcgc
tacgggggagccgaacccaacccggtggggccgccgcagtccgctgccggagcgcagggg
caggactga

DBGET integrated database retrieval system