KEGG   Thermobifida fusca: Tfu_0922Help
Entry
Tfu_0922          CDS       T00265                                 

Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
tfu  Thermobifida fusca
Pathway
tfu00380  Tryptophan metabolism
tfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Tfu_0922
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Tfu_0922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AAZ54960
UniProt: Q47RF7
LinkDB All DBs
Position
1083607..1084848
Genome map
AA seq 413 aa AA seqDB search
MTIPLTREDCAARDAADPLAPFRDEFVLPDGVIYLDGNSLGALPRATPARVARLVEHEWG
QRLIASWNEAGWWDKPRTLGALLAPLLGAEADEVVVGDGTSVNLFKTVAAALWLRPDRRV
VVAEAGNFPTDGYIAQGVVDLVDGASLRMVDVDDPAALAAALEPGDVAVVLLSHVDYRTG
ILRDMAAVTEMVHAHGALVVWDVCHSVGAVPLALAQTGVDFAVGCTYKYLNAGPGAPAFT
YVARRHHERVRQPISGWHGHARPFDFAPEYEPAAGASRFLSGSQSLIAAAALEASLELWQ
RVDLAQVREKSLALTDLFVAVTAEAGLECVTPAEHERRGSQVALRHPDDYPIVQALIARG
VVGDFRSPDILRFGFAPLYLRYVDVYDAARALVEVVTSGEWQDPRFAQRAQVT
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatccccctcacccgcgaggactgcgctgcacgggacgccgccgaccccctggcc
ccgttccgcgacgagttcgtgctgccggacggcgtcatctacctcgacggcaattcgctg
ggcgccttgccccgggccacgcctgcccgggtcgcacgcctggtggagcacgagtggggc
cagcggctcatcgccagttggaacgaggcgggctggtgggacaagccccgcaccctcggc
gctctgcttgccccgctgctgggggcggaggccgacgaagtggtggtgggggacggcacc
tcggtcaacctcttcaagaccgtggcggcggcgctgtggctgcggccggaccgccgtgtc
gtggtggcggaggccgggaacttccccaccgacgggtacatcgcccagggggtggtggac
ctggtggacggggccagcctccgcatggtggacgtggacgaccccgccgccttggccgcg
gccttggagcccggggatgtggctgtggtgctgctcagccacgtggactaccgcaccggc
atcctgcgcgacatggcggcggtcaccgagatggtccacgcgcacggcgccctggtggtg
tgggacgtgtgccacagtgtgggcgcggtgccgctcgcgctcgcgcagacgggtgtggac
ttcgccgtgggctgcacctacaagtacctcaatgccggtccgggcgcgcccgcgttcacc
tatgtggcccgccgccaccacgagcgggtccgccagcccatcagcggctggcacggccac
gcccgtccgttcgacttcgctccggagtacgagcctgcggcgggggcgagccggtttttg
agcgggtcgcagtcgctgatcgctgcggccgcgctggaggcgagcctggagttgtggcag
cgcgtggacctggcgcaggtgcgcgagaagagcctggcgttgacggacctgttcgtggcg
gtgaccgcggaggcgggcctggagtgcgtgaccccggcagagcacgagcggcggggcagc
caggtggcgctgcgccacccggacgactacccgatcgtgcaggcgctcatcgcccgcggg
gtggtgggggacttccggtccccggacattctgcgtttcgggttcgccccgctgtacttg
cgctatgtggacgtctacgacgcggcccgggcactggtcgaggtcgtcacgtcgggagag
tggcaagacccccggtttgcgcagcgtgcccaggtgacgtga

DBGET integrated database retrieval system