KEGG   Thermobifida fusca: Tfu_1386Help
Entry
Tfu_1386          CDS       T00265                                 

Definition
(GenBank) anthranilate synthase, component II
  KO
K13503  anthranilate synthase [EC:4.1.3.27]
Organism
tfu  Thermobifida fusca
Pathway
tfu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01130  Biosynthesis of antibiotics
tfu01230  Biosynthesis of amino acids
Module
tfu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tfu_1386
Enzymes [BR:tfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Tfu_1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind GATase Peptidase_C26 Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AAZ55424
UniProt: Q47Q45
LinkDB All DBs
Position
1606116..1608296
Genome map
AA seq 726 aa AA seqDB search
MDDNSYTTSGGITVHRTAVPCDPRALADLTVNVEQRRGGVLSSGMEYPGRYSRWHLGYVD
PCLEVVARGRTIGATALNDRGRVLLPAVARALTAHGAVVEHTDDTVAVTVPEPDPTEFFT
EEERSRRLSVFSALRALVGVFFHAEEPHLGLYGAFGYDLAFQFEPIEQVLPRDPEDRDLV
LHLPDEIIVHDRKREICQRYSYDFTLPEELRGPAGATTRGLPRHTEPTPPVTPAAEVPPQ
PEPGSYARIVAEAKERFRRGDLFEVVPSHRLYAPCASPARFYERLRERNPAPYEFFLNLG
EGEYLVGASPEMFVRVTGRPGEGQRVETCPISGTIKRGADAVGDAENIKELLSSAKEESE
LTMCTDVDRNDKSRVCVPGSVRVIGRRQIEMYSRLIHTVDHIEGILRPELDAIDAFLTHM
WAVTVTGAPKTWAMRFIEQHESSPRRWYGGAVGVINFDGSMNTGLTLRTAHIRDGVATVR
AGATLLYDSDPEAEERETFLKARALLETLTDEGEETSKAAPAVEQVGAGMRVLLVDHEDS
FVNTLADYVRRHGAEVTTVRYGFDPALLDQMRPDLVVLSPGPGLPADFAMSALLKELDAR
GLPVFGVCLGLQAMVEYAGGELLTLDTPVHGKPGRVRVTGGALLAGLGEDGEFTAARYHS
VYATPDRVKGFEVTAVTEDDGFPVVMAIENAEARRWAVQFHPESILTGRVGEQIVANVLR
LARESS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
gtggacgacaactcctacaccaccagtggtggtatcaccgtgcaccgcacggcagtgccg
tgcgatccccgtgcgctcgccgatctgacggtcaacgtggaacagcgccgaggcggcgtg
ctctcctccgggatggagtatcccggccgctacagccgttggcatttgggatacgtggac
ccgtgcctggaagttgtcgcgcgcggccgcacgatcggggcgacggccctcaacgaccgc
ggccgtgtcctgctgcccgcggtagcccgggcgctcaccgcgcacggcgcggtggtggag
cacaccgacgacacggtcgctgtcacggtccctgaaccggatcccaccgagttcttcact
gaggaagagcgcagccgccggctcagtgttttttctgcgctccgcgccctcgtgggcgtg
ttcttccacgcggaagaaccccacctggggttgtacggggcgttcggctacgatctggcg
ttccagttcgaaccgatcgagcaggtgctgccgcgcgacccggaggaccgggacctggtg
ttgcacctgcccgacgagatcatcgtccacgaccggaaacgggagatctgccagcgctac
tcctacgacttcacgctgccggaggagttgcgcggcccggcaggggcgaccacgcggggc
ctgccacgccacaccgagcccacacccccggtgaccccggctgccgaggtgccgccgcag
ccggaacccgggtcgtatgcgcggatcgtggctgaggccaaggagcggttccgccgcggc
gacttgttcgaagtggtgcccagccaccgcttgtacgcgccgtgtgcgtcgcctgcgcgg
ttctacgagcggctgcgggaacgcaaccctgccccgtacgagttcttcctcaacctgggg
gagggcgagtacctggtcggcgcgtccccggaaatgtttgtgcgggtcacgggccgtccc
ggagaggggcagcgggtggagacctgcccgatctccggcacgatcaagcgtggcgcggac
gcggtcggcgacgcggagaacatcaaggagctgctgtcgtccgcgaaggaagagtcggag
ctgaccatgtgcaccgacgtggaccgcaacgacaagtcccgggtgtgcgtgccaggcagt
gtgcgggtgatcggccgccggcagatcgaaatgtacagtcggctcatccacacggtcgac
cacattgaggggattctgcgccccgagttggacgctattgacgcgttcctcacccacatg
tgggcggtgaccgtgacgggggcgccgaagacgtgggcgatgcggttcatcgaacagcat
gagagttcgccgcgccgctggtatgggggcgcggtcggtgtcatcaattttgatggttcg
atgaacaccgggttgacgttgcggaccgcgcacatccgggacggggtggcgacggtgcgg
gcgggcgccacactgctgtacgactctgatccggaagctgaagagcgggagactttcctc
aaagcccgtgccctgttggagaccctcaccgacgagggtgaggaaacctccaaggctgcg
cctgcggtggagcaggtgggggcggggatgcgggtgctgctcgtcgaccacgaagactcg
ttcgtcaacacgctcgcggactacgtccggcggcacggcgccgaggtcaccacggtgcgc
tacgggttcgacccggccctgctcgaccagatgcgtcccgacctggtggtgctctccccg
gggccggggctgcccgccgatttcgcgatgagcgcgctgttgaaggagttggacgcgcgc
ggcctgcctgtgttcggggtgtgcctggggctgcaggcgatggtggagtacgcgggcggg
gagctgctcactttggacacgccggtgcacggtaaacccggccgggttcgggtcaccggg
ggcgcgctgctggctgggctgggagaggacggggagttcaccgcggcccgctaccactcc
gtgtacgcgaccccggaccgggtgaaagggttcgaggtgacggcggtgacggaggacgac
ggtttccccgtggtcatggcgatcgagaatgctgaggcgcggcggtgggcggtccagttc
caccccgagtcgatcctcaccggccgggtgggggagcagatcgtggcgaacgtgctgcgc
ttggccagggagagcagctga

DBGET integrated database retrieval system