KEGG   Thermococcus gammatolerans: TGAM_1772Help
Entry
TGAM_1772         CDS       T00920                                 

Gene name
glgP
Definition
(GenBank) Alpha-glucan phosphorylase (glgP)
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
tga  Thermococcus gammatolerans
Pathway
tga00500  Starch and sucrose metabolism
tga01100  Metabolic pathways
tga01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TGAM_1772 (glgP)
Enzymes [BR:tga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     TGAM_1772 (glgP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Glyco_hydro_71
Motif
Other DBs
NCBI-ProteinID: ACS34274
UniProt: C5A1K5
LinkDB All DBs
Position
1710807..1713287
Genome map
AA seq 826 aa AA seqDB search
MTYSVEDAIREKLPYPLGELVDLAYNYWWSWNRRATKLWEYIDPEHWRSYKNPVKLLFDT
PEERFRELVKDDDFMNLYELVIDQFQAYMNPSSTWFSTNYPKWDKPIVYLCMEYGISKSL
PIYSGGLGILAGDHVKTASDLGLPFIAVGLLYKHGYFRQEIDENGNQIEVFPEYRPEEMP
IKPVLDRNGERLLIEVPLEDRTVYARAFEVRVGRVKIYLLDTDVPENSPDDRTICDYLYN
AEMDKRIKQEILLGIGGMRLLRALGIEPGVVHLNEGHPAFANLQRIAWLMDEGLTFTEAL
SVVRGTTVFTTHTPVPAGHDKFPIEEVRKRLARFLEGREELLELGREGDHLNMTLLAIRT
SSYVNGVSKLHAEVSKRMWQGLWPGVPLNEIPIEGITNGVHTMTWVHNEMRKLFDRYIGK
VWREHTNIEGIWYAVERIPDEELWEAHLEAKRQFIELLRRKAIERNQRLGIDDPIPAMDE
NALIIGFARRFATYKRATLILSDLERLKRILNDPERPVYIVFGGKAHPMDEGGKAFLRRV
YEVSKMPEFRGKIFIIENYDMGSARLMVAGVDVWLNNPRRPLEASGTSGMKAGLNGVLNL
SIYDGWWVEGYNGKNGWVIGEESTEPETEEDDPKDAESLYRILEDEVIPTYYSNRSRWIY
MMKESIKSIAPRFSTHRMVKEYMDRFYSKAMSNYIWLTRDNYRGAREIAAWKERVMKAWD
NVEIRDASVEGDNLRVRVYLDGLSPEDVKVELYYGVRARGYEIEKPHIVELRHPTREGDE
WVYTYEGSALRHLGDPCWHYAIRVHPHHEKLPHRFLLGLVKWRGLD
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgacctatagcgttgaggatgcaataagggaaaaactcccatacccgctcggagaactc
gtcgatcttgcctataactactggtggagctggaacagaagggccaccaagctctgggag
tacatagacccggagcactggcggagttataagaaccctgttaaactgctttttgacact
ccagaagagcgattcagggagctcgtgaaggatgatgacttcatgaacctctacgagctc
gttattgatcagtttcaggcctacatgaaccccagctcgacttggttctcgacgaactac
cccaagtgggacaagccgatcgtctacctctgtatggagtacggcataagcaagagcctt
ccgatctattccggcggcctcggaatcttagctggagaccacgtaaaaacggccagcgac
cttgggttgcccttcatagccgtaggccttctctacaagcacggctactttaggcaggag
atagacgagaacggcaaccagatcgaagtctttccggagtacaggccggaggagatgccg
atcaagccagtccttgacaggaacggcgaaaggctcctcatagaggtccccttagaagat
agaacagtttacgcaagggcctttgaggttcgggtcggcagggtgaagatttacctcctc
gacacggacgttcccgagaacagcccggacgacaggacgatatgcgattatctctacaac
gccgagatggacaagaggataaagcaggagatactcctcggcatcggcgggatgaggctc
ctgagagcattgggaatagagcctggtgtcgtccacctcaacgagggacatcctgccttc
gcgaacctccagaggattgcatggcttatggatgagggcctcaccttcaccgaggcgctg
agcgtcgtcagggggacgacggtcttcacaacccacacgcccgtccctgcaggccacgac
aaattcccgattgaagaggtccgaaaacggctcgccaggttccttgaaggtagagaagaa
ctcctcgaactcggtagagaaggggatcatctcaacatgaccctcctcgcaataagaacg
tcgagctacgtgaacggcgtcagcaagctgcatgcggaggtcagcaagaggatgtggcag
gggctctggccgggggttccgctcaacgagataccgatcgagggcataaccaacggagtt
cacaccatgacatgggtacataacgagatgaggaagctctttgaccgctacatcggcaag
gtctggcgcgaacacacgaacattgagggaatatggtacgcggttgaaagaataccagat
gaagagctctgggaagcccaccttgaggccaagaggcagttcatcgagctactcaggaga
aaagcgatcgaaaggaaccagcggctcggcatagatgacccaataccggctatggacgag
aacgccctgataataggtttcgcgaggcgcttcgccacttataaacgcgccaccctgata
ctcagtgatcttgagaggctgaagcgcatactcaacgatccggagaggccggtctacata
gtcttcggcggaaaggcccacccaatggatgagggcggtaaggcctttctccggagggtt
tacgaggtcagtaaaatgccagaatttcgggggaagatcttcattattgagaactacgac
atgggtagcgcgaggctcatggtcgccggcgttgacgtctggcttaacaacccgcgcagg
cccctagaagccagcggaacgagcggaatgaaggccggtcttaacggtgttctgaacctg
agcatctacgacggctggtgggttgaaggctacaacggaaagaacggctgggtcatcggt
gaggaaagcactgagccagaaaccgaggaagacgacccaaaggacgccgaaagcctctac
cgcatccttgaggatgaggtaataccaacctactactccaaccgttccaggtggatctac
atgatgaaggagagcataaagagcatagccccccgcttcagcacccacaggatggtgaag
gagtacatggaccgcttttactccaaggccatgagcaactacatatggctcacaagggac
aactacagaggcgccagagaaatagccgcgtggaaggaacgagtgatgaaggcatgggac
aacgttgaaataagggacgcaagtgtggagggggacaacttgagggtcagggtttacctc
gacggcctctcccccgaggatgtgaaggtcgagctctactatggagtcagggctaggggt
tatgagatcgaaaagccccacatcgttgagctgaggcatccaacgagagagggtgatgag
tgggtctacacctacgagggaagtgccctgaggcacctcggggatccctgctggcactac
gccatccgcgtgcacccccaccacgagaagttgccccacaggttcctgcttggcctcgtg
aagtggagaggccttgattga

DBGET integrated database retrieval system