KEGG   Thermococcus gammatolerans: TGAM_2005Help
Entry
TGAM_2005         CDS       T00920                                 

Definition
(GenBank) ATP-dependent DNA ligase, putative
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
tga  Thermococcus gammatolerans
Brite
Enzymes [BR:tga01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TGAM_2005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ACS34507
UniProt: C5A288
LinkDB All DBs
Position
complement(1906599..1907741)
Genome map
AA seq 380 aa AA seqDB search
MVSSIFRNLLLKLGLPEGRLEVLEGKGGLMEDEFEGIGYVRFRDSARGFRRGTVVFEDGT
VVAGFPHIKRVVQLENGIRRIFRRRPFYVEEKVDGYNVRVVTVKGRILALTRGGFVCPFT
TERILDFINEEFFRDYPNLVLVGEMAGPESPYLVEGPPYVEEDIQFFLFDIQEKGTGRSI
PAEERYKLAEEYGIPQVEVFGLYDRSMIEELYDLIERLSREGREGIVMKTPDMRKIAKYV
TPYANINDIKIGSRIFFDLPHGYFMQRIKRLAFYLAEKRVRGEEFDEYARALGKALLRPF
VESIHEVASGGEVEETFKVRVKNVSTAHKMVTHFERLGVKIHIEDIEDIGNGYWRITFKR
VYPDATREIRELWNGLAFVD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtcagttcgatctttcgaaacctcctcctgaagcttggcctcccggaggggagactc
gaagttctcgagggaaaaggcggccttatggaagacgagtttgaggggattggatacgtt
cgcttccgcgactccgcgagggggtttaggaggggaaccgttgtattcgaagacggtaca
gttgtcgccggatttcctcacataaagagagttgttcagcttgagaacgggattaggcgg
atcttcaggagaaggcccttctatgtggaggagaaggttgacggctacaacgtccgcgtc
gtcacagttaagggcaggattttagcgctcacccggggcggttttgtgtgccccttcaca
accgagcgaatactcgatttcatcaacgaggagttcttcagggattaccccaacctggtc
ctcgttggggagatggccgggccggagagcccttacctcgttgaggggccgccctacgtt
gaggaggacatccagttcttcctcttcgacatccaggaaaaaggaactgggaggagcatt
cctgctgaagaaaggtataaactcgccgaggagtacggtattccacaggtagaggtcttc
ggcctctacgaccgttcaatgattgaggagctctacgaccttatcgaaaggctcagcagg
gagggacgggagggcatcgtgatgaagacacccgatatgaggaaaatagcgaagtacgtg
acgccctatgccaacattaacgatatcaaaatagggtcccgcatcttctttgacttgcca
cacgggtacttcatgcagaggatcaagaggctggcattctatctggcggagaagcgcgtc
aggggtgaagagttcgacgagtacgcgagggccctcggcaaggccctcctccggccgttt
gtcgagagcatccatgaagttgcgagcggtggggaagtggaggagaccttcaaggtcagg
gtgaaaaatgtgagcaccgcccacaaaatggtgacccacttcgagagactcggcgtgaaa
atccacatcgaggacatagaggacatcggaaacggttactggaggataactttcaagcgc
gtttatcccgatgcgacgcgtgagatcagagaactgtggaacggtttggcatttgtggac
tga

DBGET integrated database retrieval system