KEGG   Thermococcus gorgonarius: A3K92_00620Help
Entry
A3K92_00620       CDS       T05047                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
tgg  Thermococcus gorgonarius
Brite
Enzymes [BR:tgg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A3K92_00620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ASJ00093
LinkDB All DBs
Position
119088..120230
Genome map
AA seq 380 aa AA seqDB search
MVSSQFRDLLLKLGVPEDRLLVLEGKGGIVEDEFDGIRYVRFRDSARGFRRGTVVFENGE
TVLGFPHIKRIVQLENGVKRIFKSRPFYVEEKVDGYNVRVVKVEDRVLALTRGGFVCPFT
TERIEDFVNFEFFKDYPNLILVGEMAGPESPYIVEGPPYVKEDIEFFLFDIQEKGTGKSL
PVEERYKLAEEYGIPQVERFGMFDRSRLDELYDLIERLSREKREGIVMKSPDMRKIAKYV
TPYANINDIKIGSHIFFDLPHGYFMGRVERLAFYLAEKHVKGEEFDEYAKALGKALLRPF
VESIHEVANGGEVEETFTVRVKNISTAHRMVTHFERLGVNIHIEDIEDLKNGYWRITFKR
VYPDATREIRELWNGLAFVD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtaagctcacagttcagggatctgctcctcaaacttggcgttcccgaggacaggctt
ctcgttctagagggtaagggaggcatcgttgaggacgagttcgatggcatcaggtacgtc
cgcttccgcgattccgccagggggtttcgcaggggaacggtggtcttcgagaacggcgag
acagtcctcggctttccccacataaagagaatcgtccagcttgagaacggggtaaagcgg
atcttcaagagcaggccgttctacgtcgaggagaaggtggacggctacaacgtccgcgtc
gttaaagttgaggacagggttcttgcccttacccgcggcggcttcgtctgcccgttcacg
acggagagaatagaggactttgtgaacttcgagttctttaaggactatccaaatctaatc
ctcgttggagaaatggccgggcccgaaagcccttacatagtcgagggaccgccctacgtg
aaggaggacatagagttcttcctcttcgacatacaggagaagggaaccggaaagagcctg
ccagttgaagaacgctataaactcgcggaggagtacgggattccgcaggtcgagcgcttc
ggcatgttcgaccgctcccgcctggatgagctctacgacctgatagagcgactcagcagg
gagaagagggaaggcatcgtcatgaagagcccggacatgaggaagatagcgaagtatgtg
acgccatacgccaacatcaacgacataaagataggctcgcacatattcttcgacctcccc
cacggctacttcatgggaagggtagagagactcgccttctacctcgccgaaaagcacgtc
aagggagaggagttcgacgagtacgccaaagccctcggaaaagccctgctgaggccattc
gttgagagcatccacgaagttgccaacggcggagaggtcgaggagaccttcactgtgcgg
gtcaagaacataagcaccgcccacaggatggtcacccacttcgagaggctgggcgtgaat
attcacatcgaggacatcgaggatttgaagaacggttactggaggataaccttcaagcgg
gtctatcccgacgcgacgagggagataagggagctgtggaacgggttggcgtttgtggac
tga

DBGET integrated database retrieval system