KEGG   Thermococcus gorgonarius: A3K92_07015Help
Entry
A3K92_07015       CDS       T05047                                 

Definition
(GenBank) type III ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tgg  Thermococcus gorgonarius
Pathway
tgg00630  Glyoxylate and dicarboxylate metabolism
tgg01100  Metabolic pathways
tgg01120  Microbial metabolism in diverse environments
tgg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A3K92_07015
Enzymes [BR:tgg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     A3K92_07015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N LigA
Motif
Other DBs
NCBI-ProteinID: ASJ01245
LinkDB All DBs
Position
complement(1261635..1262969)
Genome map
AA seq 444 aa AA seqDB search
MVEKFDKIYDYYVDKGYEPNKKRDVIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYP
WYEEERWADMSAKAYDFVDMGDGSWIVRIAYPEHIFEEGNMPGFLASIAGNVFGMKRVEW
LRLEDIYLPEKFLRNYPGPAFGIEGVRKKLEIYDRPLYGVVPKPKVGYSPEELYKLALDL
YTGGADYLKDDENLTSPWYNRFEERVKVVTKAMEKAENETGEKKTWFANITSPILEMEQR
LEILADYGVPHAMVDVVVLGWGVLDYIRELAEDYGIALHAHRAMHTAFARYKYHGISMFV
LAKLYRVIGVDQLHIGTAGAGKMEGEKWEVIQYKRIITEDHYVPDENDVYHLEQKFYHIK
PVFPTSSGGLHPGNIQPVIEALGKDIVLQLGGGTMGHPDGPKAGAMAVRQAIDAIMQGIP
LDEYAKTHKELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggttgagaagtttgataagatatacgactactacgtggacaagggctacgagcccaat
aagaagagggacgtaatagccgttttccgcgttactccggcagagggatacacgatcgag
caggcggcaggtgcagttgccgccgagagctcgaccggaacctggacgaccctttatccc
tggtacgaggaggagcgctgggccgacatgtcagccaaggcctacgacttcgttgacatg
ggtgacggcagctggatcgtcaggattgcctacccggagcacatctttgaggagggcaac
atgcccggcttcctcgcgagtatagctggcaacgtctttggaatgaagcgcgttgagtgg
ctccgccttgaggacatctatcttccggagaagttcctccggaactacccgggaccggcc
ttcgggatcgagggtgtcagaaagaagctcgaaatctacgacagaccgctctatggtgtt
gttccaaagccgaaggtaggctactcgccggaagagctctacaagcttgccctcgacctt
tacaccggtggagcagattatctaaaggatgacgagaacctcaccagcccgtggtacaac
cgcttcgaggagcgcgttaaggtcgtcaccaaggccatggagaaggcagaaaacgagact
ggagaaaagaagacatggttcgctaacattacctcgccaatactcgagatggagcagagg
cttgaaatactcgccgactacggcgttccccacgcgatggttgacgttgtcgtcctcggc
tggggcgtcctcgactacatccgcgagcttgccgaagactacggcatagctttgcacgcc
cacagagcgatgcacaccgcctttgcccgctataagtaccacggcatctcgatgttcgtc
ctggccaagctctaccgcgtcatcggcgttgaccagctccacatcggcaccgctggggcc
ggcaagatggagggcgagaagtgggaggtcatccagtacaagaggataatcaccgaggac
cactacgttccggacgagaacgatgtctatcaccttgagcagaagttttaccacatcaag
cccgtcttcccgacgagctctggaggacttcaccccggcaacatccagcccgtcatagaa
gccctcggaaaggacatcgttttgcagctcggcggtggaacgatgggccacccagacggg
ccaaaggcaggagcaatggcggtcagacaggccatcgatgccatcatgcagggaatccca
ctcgatgaatacgcgaaaacccataaagaactggcaagggctttggagaagtggggccac
gttacccccgtttga

DBGET integrated database retrieval system