KEGG   Toxoplasma gondii: TGME49_206550Help
Entry
TGME49_206550     CDS       T01093                                 

Definition
(RefSeq) hypothetical protein
  KO
K17570  hydrocephalus-inducing protein
Organism
tgo  Toxoplasma gondii
Brite
KEGG Orthology (KO) [BR:tgo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tgo01009]
    TGME49_206550
Protein phosphatases and associated proteins [BR:tgo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TGME49_206550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ASH PapD-like DUF1573 Motile_Sperm AAA_33 AAA_16 AAA_18 AAA
Motif
Other DBs
NCBI-GeneID: 7894169
NCBI-ProteinID: XP_018637245
UniProt: S8F2G6
LinkDB All DBs
Position
VIIa:join(843015..843139,843648..843750,843958..844029,844769..844828,845471..845692,846189..846257,846836..847257,847705..847837,848825..849031,849466..849972,850546..850776,851627..851878,852572..852802,853347..853513,853921..854130,854863..855089,855516..855725,856440..856673,857152..857331,858136..858269,859421..859594,860584..860818,861228..861374,861833..862175,862899..863351,863869..864107,864751..864983,865859..867264,867912..868227,868890..869103,869590..869881,870323..870567,871640..871790,873031..873321,873890..874286,875063..875275,875721..875969,876612..876936,877385..877578,878053..878892,879855..879980,880710..880922,881593..881962,882354..882522,883168..883403,883827..884024,884590..885106,885724..885861,886366..886585,887217..887432,888663..889213,890382..890556,890962..891726,892411..892533,892882..892984,893613..893674)
Genome map
AA seq 5044 aa AA seqDB search
MEPRVRNSSLAPGELLFEPDPQVVFFVDFELFKTYECVLRLRNRDSFARRVQVLQPDTRA
FVILPGKGGIGPASPKMPFWIGFRVGCLFQVAPGMTTCFTVQFTPDAREDYISELVVVTE
REKFIVPLRAICGIGFLDLPPSVAFNPTPVKVKGEKTILLRNTGTKAMVFTIHTTPPFSA
VSTRCFLDVGDSTQVTFSFEPARVSTYSSVALLRTTEGLEFSTDLIGKGVNADVKLSAAF
LKMENTSVALIHEKTVHLHNNSDHHLDFCWSLLTDDSRTEFDQTSDAVTPRKNGSCEDET
LLVPTSTQPGDWQEDPVFQIFPSEGRVWANTSLVFKVVFRPALALRYRRIATCAIAGREA
PLSLELEGTGTGPKAQFLETDVDLGPIVVHTETTMENELMNQGDIGATFSLRKSTSLAQS
MFSFTPEGGHLAVGETVKIKTRFHARALGTFEETFHWWINDLPQPLQTTFRGEVLPPVLK
LDPSSIDFGRLALGFSETRRVTLKNASSAPQPFRLRLEAAQQESETGTQENEVEKTEAKQ
EFGIHPVEGILEARGTQEVALVLTPAKAQAYNTHLIVDLGSLAPQLLSVPVKATCELPTL
TFESDDILHFGDVFVGHAYSQKIFIRNPSALPARYEVSVQEIEAGQVTLHVEEGAGAIEG
LERRSVSVHLCAKTTGSVAASLSLSVVGGKEPTSLRLRATSCGPRVRAEPKELDWGKVPC
LEEAPRCVKVTNTCPIPAEVTCALRGKEGCFRLNRHLLTLAPGASEILEVTAAFQEPVQQ
QELLVLSVADGAEIPVTLRGLGTQTPVVFSRDLTLVDFGMFYTGQLKSFKFTAANRGRRA
RKLSWVDACRAEKQLHLTENAFTVVPETVVLEPNASAAFEYKALSQAPGHLVHAFVCTEL
SGIGAKSVPILKSTAKADVYLPSLSFSSNTVSFRYIWREGDSGDHLTQDILCTNETPLPA
ICSFKAAPPFSVSPSKLNMKEKGTGTLTVTFDPAFNGRVCSKIKEKLEATYDGHAKTESV
ELRAEVVYPAVEIDTKEVDFGCIFNETSRRLAITLRNPTELPVVYHWYLTPHYDFRYVSG
DNDVPLALVNTAAPPPINKVFDFLPFTGSIEPGESETICATFFGVPDVRVTATALCVIEN
GPEFSLSLKGQASLPTFRLSQTEFDFGEVPYNRAAESELTIHNTGLVDVQFFVDLSKLDF
PWLVDVSKRAGKIPSRDKQKLTIRFRPGMPMEFRQKLYLEIGPFEPVPLFIRGIGIFASL
SLNLPRRDESNHQRKKTEMLQRLSTAERAVRGEGEEMRLARLRRPELSLEEQAEREVDRL
EICQYLHAQYLSSTGEAWGTKAKAVLEGVRVTAGQYVCDFGNIVVGQSRKKTIRIANLSS
APISLRTNQRTVATLGFAVEPGSILRLGPGEETTLSVSTACDKEGAAAGTLQLQTAEGPV
YSIHLQASFVIPDLTISTDKVDFGTVKRGQRKTIYVRFRNAVAVPVDWRLRDRIDKHKPQ
ASVQAFGVEPTQGTLNPGEFVDVKLYYYAESSEKETTTKLFFQVEDNPRWKSISLRGRTQ
VTQLSVSPSGLLEFQCCLPHQPVKREISIVNLSGSPCEVCAVDFDEQHKLFEYVLRDYPD
FDDKGFAFLPVRKPGKPFWRRVLRRALQCVRQDSSDQQLQLVATEIGGDAAGDASAQGVP
GQVAEVATTEKGFAFATTAQEVAHASTSGAAPTVKESQSRHGEESTHATPCSRWPGAALP
TLQRLPTEATLCECIEPENVEWSESESEPEATDVPFRVPTEKRVNALVVGPACVGKTSVA
HFLAKESRRKLLTIDDCLDWVVAAERQKQRRLKDDEAFSSLATSVRKALAANREAENEQP
RRGNRGKKTEARTHPSEPRASLSPELLAACVRYRTAMPDCFAGSVFDGCSSALVNVEPPV
IAHCVAEALAQEQLVLISIKFGDPQTDVERRASSPALSDEAIACGVQFYKHLSAVLQEQE
KRFQDQLETQASEGQGRGETGRRGRLGQTTSDGGCASSETPGASSTSVDDAGSGLSALHG
RGREGAVSRDVSANERDVEDLKGVLAGVQALRQKLEAVVSGKTAHLYVAEQIAFADKIEN
ALFSPERFESHFVLVEEASRASDVGDELEVKEASQLSSCRLPPSSVLAQEATDGTQNSSP
VDKQSSRSRPTPNATSSSSSCSSFPSSSSSSSSSHSTSAASSSSASASSSSSSTSSSSSS
SALASSEPGRAKRQGARKDRTSPRSSGAVPSHGEKGRTSLSMSTRLASLSSVSTAVVPTA
SPRRVPTLFRLMASAAKSLAEMREAAGRQLPAPEIPSEPPIPSPELHEIARRPPVASASP
QSGAQTQKHPPPVNFSLFIPIVPGPEEGGVPGQAVDVSPEVGDSKGSKGLARKTKDSPAP
RSRVRADKREEASSAVAKSLESEPAHMRATRWVLGPHEEQRVLVKFCVDQTGVYETGLAF
SVVGDSQSLLRVGVRATCSVPKLSMSPKQLFRQVLRARPSEREGLVCKQFIVDEGVYDFG
PLLLGRPSAPAKGLYSKLGDGDSVDAVKLPEDLQKYQESITLCNISPFDTTVRCTLQSAS
PAPDSGDHTGRKKGASKGALIRENPFFVYPSEVSLEGNSCSTVHLWCFPKTEGDVRDTLV
LWVRDNPTPAEIPLVARGALPKVTVDADYLQFGRVLFGHSVSRALSLKNASPLPARWSLL
NVDALQKLFKVGPDTEGTLEAFEELQLLFTFSPTQKAASLQTRVSIRITDVDGTGQAQET
KTISVDADAYWIDVATDFGGKGKTIDIGNVRVGETAELPLSITNKGKFPVKFAFRVKSKV
LRSILTFHGPTADLAPGEHRRMSLRCSPQREMDFCEAEEVFLDLQDAESGAVLNPALPPF
PLSLHADFNYVSLLPARGINFGPTESGKTHSLQFEVLNDGRFPFEWLLQDADQLSRLCSA
TVENAGKALTEAESPVPALGPSPKETRARAGDRSGAAAGGASKAGAPGKSSKSPGTRQMS
SFAQWGPFRLSPVKGQLEPGGKVTVDVQYSAQGDANHSLKLALLVQGVKVERGEEVVISN
VGCLGALTAEGGEGTGDAKGEKALREVLSGCSGPLIPAAEYIIQAQSCVPAIVTDPEWVF
EEQFLVSNAEEAAVWNGLRTTPMYLLEEKCLLFGSVTPNSDVNKAGIQAQIRIGNPKSVP
AAVSLEIKLSKDTDKSLLSHILSSLLTLASSVSFSPLVSQTTDSESVFEVQPKHLSLGPH
ETKTATLTFHPSALQRYAAAFRAFVNRSAADGGNAALAFDVRGEGTLPTVSLEVAPSDAA
GSAHASGEKSFFPSIAMGKVAVGTTATAVCLLKNYGTIAATARCEWPAADGITVELPPAV
TLNPGDSKTFAVHLVAQAPGEIDSSFRIYTVSNPYEDVTCRVRGTCYLEECRWSTSPSRS
SGLTPPTCLQGSPGPLNATSGVRGSPSAAAGTGVSLGERTAVSFDAALSPRLPERQGDQP
ASTVDFGDVAPDDRVSRTLFFENTTDSFMKFEVVSPLPPDLRKVLQISPIAGFLAPRGAQ
EVTLVFTSKEPVAVSAVCVPCRAWRLKASSSTAAAAVAKTKSRAKSAASVQDSEGIEEHD
GQFYQMENGREIDLPLFISARCDTRQCELECQDIVFESTMMFKSKEFVFTLTNPAKVTLP
FEFRWEDTDALLDNPSFYVLSPSKGVVPPSSKMDISLEFTPTELAVFKRFLVCSFPSLPY
GEETRKMTVDATAVRPICHFDLPPSDYRDRREQTNLPALDPKIQVVEIVSVGIGVKNTKR
FFVLNPSSSDLDFEWEPLSSDSAPHSLKADAGGLASSQACRDRVASARCASPGAGTPRRT
GFLPPVEGVRCVNLRGRIAAGRKTEVVLEFLPNKPKTQERLWKFCIPSRKLEQLFLFVGR
VKEPHVALDCSSVCFNPVLLGGKVEEVVNIHNKEDIPLSFAFSRKQAESEKSPLPPCLVV
SPRHGVLPPNSVTPVRLRFKPEDEKPFKCSLLCRVRQKVRPLSLGVRGAGYSVKHSMVLL
NEDGSIRQFASGSQSASLLDFGPLLLGQTRRYLLQLQNAGSFDFRFHWSIQSVSTVSCSP
SLSVSPTEGVVETGRNCEVTLTYAPAEISKHEEYLLLCSISGSDPYRIRAQGSCSSPKVS
FSFSSHDFGAFVLPPSLFPDLGSVVALSSPSSGGSAISDRVELKITNLDPHHDCFISTPF
EKSNVLDVQLVPCSIGPGEKISVTLVFAPKQAKNYRFKIPFSINDRTTAHVTVTGKGIPA
RLELSPSSDEIRFAPLIKGESAVKHVRIVNRTEASLEFFLPASPNLSSRGISWKPLSSET
KPFSLHPRQELPLEVSFKPALSIPEFSLPLFAECLVKRGGLTYRFPSLLCHIAAKSFETE
VRLSQPSLAFGPIVVNSWATQIVKLTNIGELFMHFKFKTSTKYSQMVSLSPSEGLLHPHA
DVPIEVTFRPTEVTQKRIVVDDIICLIKASGASASNVETSSLSLTVTGQGVAQPSDSVQT
LQFSTAVRTQQTKTFQVKNSKKYDWSTTPLVACESPKDAMYFLCSPSGRVTIPANQKVTF
QVTYSPLTMTRASSSVREGTLSAEEVDGVNRKEQRERGDGACNGHLADKDNHPRLPLFHA
ASVFIPLPDGEAATCRFIGQATEPTVEQVVDASIVCREKQIQAIKIRNWIPVKQKFDVAY
TITQCTGDTPPQIQAPDRFELPASQAREYRFLASAFKPCAAVVQFRFTSREKADFYLAEA
RLTFTDPETVGTIALETTVRQLAKTKVLVENPSTRKAVFQCQSNVADVCFSPSPLEVPPG
ATGALEVSLRANVSGAGEGTIVLTSDELGTYKYLLKYSVSAGEIEKHATFSAPLGKEVSE
TLRFLHFAKKPTTYLATIDFAPDETRGGGRSKASGSVENFFLENKSVAVSGDVENRGTEF
AVGVRFAPSKLAETKATLVLRSAEGFEYKALLIGRAQPPQPQGPFRLGKGKCINIDFRNP
FETQTEFSLQVDRPCFSVEKKVVKLEARKSTTISVQVKPDARDAGRLIVTADGIPPWIFY
LKAD
NT seq 15135 nt NT seq  +upstreamnt  +downstreamnt
atggagccccgtgtaagaaactcgtcactagctcctggggaactactctttgagccagat
cctcaagtcgtcttcttcgtcgatttcgagctgttcaaaacttacgaatgcgtcttgaga
ctgcggaatcgagactcgtttgcccgacgagttcaagttttgcagccagacacacgcgcg
tttgtaattcttccaggcaaaggtggaattggtccggcctctccgaagatgcctttctgg
atcggtttccgtgtcggatgtctatttcaggttgcaccaggcatgactacatgcttcaca
gttcagttcaccccagatgctcgtgaagattatatttccgagctcgttgtcgttacagaa
cgagagaagtttattgtgcctcttcgcgcaatctgcggcatcggattcttagacttacca
ccgagtgtcgctttcaacccaactccggtgaaagtgaagggagaaaaaacaatcctactt
cgaaacaccgggaccaaggccatggtgttcacaatccacacaacaccccccttttcagcg
gtttcgactcgctgcttcctagatgtcggcgattctacacaggtgacattctccttcgag
cctgcccgagtcagcacttactcttccgttgcgctgttgcgcacgaccgagggtctggag
ttctccacagacctcataggcaagggggtaaatgcagacgtgaagctgtctgctgcgttt
ctgaaaatggaaaacacctccgtcgctttgattcacgagaagactgtgcatctccacaac
aactccgaccaccacctcgatttctgctggagccttctgaccgacgattccaggaccgaa
ttcgaccagacatcggacgccgtgacacccaggaaaaacggatcctgtgaagacgaaact
cttctggtaccgacaagcacccaacccggagactggcaagaagaccccgttttccaaatt
ttcccttcagagggacgagtatgggccaacacgtcgctcgtgttcaaagtcgtttttcgg
cctgccctcgccctgcgctacaggcgaattgccacatgcgccattgcgggaagagaagca
cctctttcgcttgaactagaaggtactggcacaggaccgaaggcgcagttcctcgaaacc
gacgtcgatttgggtccgattgtagtccatactgaaacaacaatggaaaacgaattgatg
aaccaaggcgacataggcgcaacgttttctcttcggaaatcgacgtctctagcccagagc
atgttctcatttaccccagaaggaggccacctggctgtgggggagacagtcaaaatcaaa
actcgtttccatgcgcgagctctcggcacctttgaggaaacattccactggtggatcaac
gaccttccacaacctttacaaacaacgtttaggggagaagtcttgcctccagtcctgaag
ctcgacccatcttcgattgactttgggaggctcgctcttggcttttctgagactcgccgc
gtgactctaaaaaatgcatcatctgcccctcagccgttccggcttcgcctagaagctgca
caacaggaatctgagacaggaacacaggagaacgaagtcgagaagactgaagccaaacag
gaattcggtattcatccagtggaaggaatcctggaagcgagagggacgcaagaggtggct
ctggtgctcaccccagccaaggcgcaggcgtacaacactcacttgattgtcgacttaggc
tcgttggccccgcagttgctttccgtgcctgtgaaggcgacgtgtgagctgccgacactg
acgttcgagtccgacgacattctccacttcggcgacgtttttgtgggacatgcttactct
caaaaaatcttcattcgcaatccttcagccctaccagcgaggtacgaagtctctgttcag
gagatcgaggcaggccaggtgactctccatgtggaagagggagcaggtgccatagaaggc
ctggaaaggcggagtgtttctgttcacctctgcgcaaagacgacaggctccgttgcagcc
tccttgagtttgtcagttgttgggggcaaagaacccacctcgctgaggctgcgggcgaca
tcgtgcgggcctcgcgtgcgagcagaaccgaaggagctggactggggaaaagtgccgtgc
ctggaagaagcccctcgatgtgtaaaggtgacgaacacttgcccaattcccgcagaggtc
acttgcgccctgaggggaaaagaaggctgctttcgtctgaaccgccacctcctcacatta
gctcctggtgccagcgaaatactggaggtcaccgcggcctttcaagagcctgtgcaacaa
caggagctccttgttctctctgttgccgacggagctgagattcccgtcacgcttcggggc
ctgggcacacagacacccgtggttttttcccgcgacctcactctcgttgactttggaatg
ttttacacggggcaactgaagagcttcaagttcacggcggcaaaccggggacgacgagct
cgaaagctttcgtgggtcgacgcatgcagagcagagaagcaacttcatctgacggaaaac
gcctttacagtggtgccggagactgtcgtgctggagccaaacgcctcggcggctttcgag
tataaggcgctgagtcaggctccaggccatctcgtgcatgcatttgtgtgtacggagctc
tcgggcatcggagccaagtcggttccaattctgaaaagcacagcgaaagcagatgtttat
ctgccgtctctctccttctcatccaacaccgtttccttccgatatatttggagggaaggc
gactcgggagaccacctgacccaggacattctgtgcacaaatgaaacgccactgccggct
atatgctcgttcaaagcagctccacccttctccgtttcgccgagcaaactgaacatgaag
gagaaaggcacaggcactctgacagtaactttcgaccccgctttcaacggaagagtctgc
tcaaaaataaaagagaagctggaagcgacatacgatggtcatgcaaagacagaaagtgta
gagctgcgagcagaagttgtctatcctgcggtggaaatcgacacgaaggaagtggacttc
ggttgcattttcaacgagacaagtcgacgcctcgccatcactctgagaaacccaacagaa
ttgccagttgtctatcactggtacctgacccctcactacgacttccgctatgtgtccggc
gacaacgacgtacccctcgcgctcgtgaacacagccgccccccctcccatcaataaagtt
tttgattttctccctttcacgggatccatcgaacctggagagtcagagacaatctgcgcc
actttctttggggttccagacgtccgcgtaaccgccacagcgctctgtgtgattgagaac
ggtcccgagttttctctcagtcttaaagggcaagcctccctcccgaccttccggttgagc
cagactgaattcgactttggagaagttccgtacaaccgcgcagctgagagcgaactgacg
attcacaacacaggcctcgttgatgtccagttcttcgtcgacctctcaaagctcgacttc
ccctggctcgtggacgtgagcaaacgagctgggaagataccctcgagggacaaacagaaa
ctcacaattcgattccgaccaggcatgcctatggagtttcgccagaagctctacctggag
attggacccttcgagccggtgccgctcttcattcgcggcatcgggatcttcgcgagtctc
tccctcaatctgccgagaagggatgagtcaaaccaccagagaaaaaaaacagagatgctc
cagagactctccacagcagagcgcgcggtgaggggggaaggagaagaaatgagactcgca
cgtctccggcggcctgagttgtcactggaggaacaagccgaaagggaagtcgatcgtctg
gagatctgccagtacttacatgcacagtatctctcgtcgaccggagaggcctgggggaca
aaggcgaaagcagtgctcgagggagttcgagtgacggcggggcagtacgtctgcgacttt
ggaaacatcgtcgtgggccagagcagaaaaaagacgattcgaatcgccaacctgtcgtcc
gcgcccatttcgctgcgaaccaaccaacgcactgtggcaactctcggctttgctgtcgaa
ccgggatccattcttcgcctcggaccgggagaagaaaccactctgagcgtctcgactgcg
tgcgacaaggaaggcgccgctgctggaactcttcaacttcaaaccgctgagggacccgtc
tactcaatccacttgcaggcctcctttgtcattccggacttgactatttccacggacaaa
gtggactttggaacagtcaaaagaggtcaaaggaagaccatttacgtccgatttagaaac
gccgtcgctgttcctgtcgactggcgactgcgcgacagaattgacaaacacaagccgcaa
gcgagtgtgcaggcctttggcgtagagcctacacaggggactctgaatccaggcgagttc
gttgatgtgaagctttactactacgccgagtcgagcgagaaggaaacgacgacgaagttg
tttttccaagtggaagacaatcctcgatggaagagcatatcattgcgcggccgcacacaa
gtgacgcagctgtctgtctctccgtctggcctcttggagttccaatgttgccttcctcac
cagcctgtgaagagagaaatctccatagtgaatctcagcggatctccttgcgaggtatgc
gccgtcgactttgacgaacagcacaaactctttgagtatgtgttgagagattatcccgac
tttgacgacaaaggcttcgccttcctcccagtcaggaagccggggaagccgttctggagg
cgagtactgaggagagccttgcagtgtgtgcgccaggattcgtcagaccagcaactgcag
ttggtggcgacggagattggaggggacgccgcaggagacgcttcagcccagggcgtcccc
gggcaagttgcggaggttgcaacaactgaaaaaggttttgcgtttgcgacaactgcgcag
gaagtcgctcatgcatccaccagtggtgccgcaccgactgtgaaggaatcgcagagcaga
cacggtgaggaatcgactcatgcaactccctgcagccggtggcctggcgcagcgctccca
acgctccagcggctgccgacggaagcgacactctgcgagtgtatcgagccagaaaacgtg
gaatggagtgaaagcgagtctgagccggaggccacagacgttccgtttcgcgttcccacc
gagaaacgagtgaatgcactcgtcgtcggccccgcatgtgtggggaaaacctcagtcgct
catttcctagccaaggaaagccggaggaaacttttgacaatcgacgactgcctggactgg
gtcgtggcggcagagaggcagaagcagcgaagactgaaggacgacgaggcattttcctct
cttgcgacaagcgttcgaaaggctcttgcggcaaatcgagaagctgagaatgagcagcca
cgaagaggcaacaggggaaagaaaaccgaggcgagaacgcatccgtcggagccgcgagcc
tccctttctcctgagcttctggctgcatgcgtccgctacagaacagccatgcccgactgc
ttcgccggatctgtctttgacggatgcagctccgcgcttgtcaacgtagagccgccggtg
atcgctcactgtgttgccgaggccttggcgcaggagcagctggtgttgatttccatcaaa
tttggtgaccctcagacagatgtcgagcgtcgcgcttcgtcgccggctttgagcgacgaa
gcgattgcatgtggggtccagttctacaagcatttgtcggctgttcttcaagagcaagaa
aagcgcttccaggatcaattggagacccaagcctcagaggggcaggggcgcggcgagact
gggcgtcgcgggcgtctcggccaaacgacttctgatggcgggtgcgcgtcgtccgagacg
cctggcgcgtcttcgacctctgtggacgatgcaggttctggcctgtctgctctgcatgga
cgcggaagggagggcgctgtttcgcgggatgtttcggcgaatgaaagagacgtcgaagat
ctgaagggagtgctcgccggggtacaggcgctgcggcagaaacttgaagctgtcgtctca
gggaagactgcacatctgtacgttgcggagcaaatcgcctttgcagacaagattgagaac
gctcttttctctccggagcgatttgagtctcacttcgtcctggtggaagaggcgtctcgt
gcttcggatgtcggtgatgaactcgaagttaaagaagcctcgcagctctcgagttgtcgc
ctcccaccgtcttcggtgcttgcacaggaggcgacagatggaacccaaaacagttcacca
gtcgacaaacagtcctcgcgttctcgtccgaccccaaacgccacctcgtcgtcttcttct
tgttcttcgtttccctcttcatcatcttcgtcgtcgtcatctcactccacttctgccgcc
tcctcgtcttccgcttctgcttcatcttcttcctcttctacttcctcttcttcatcatct
tccgctttggcttcgtcggagccaggtcgagcgaagcgtcagggtgcaaggaaggatcga
acgtcgccgcggtcgtctggagctgttccctcgcatggggagaaaggcaggacgagtctt
tcgatgtccactcgtctcgcctctctttcctctgtttccactgccgtcgttccgactgct
tcacctcgtcgtgttcctacgctcttcaggctgatggccagcgccgcgaagtctctggct
gagatgagagaagctgcagggcggcagttgcctgctcccgagattccgtcggagccgccg
attccttctccagaactccacgaaatcgcgcggaggcctcctgtggcgtctgcatctcca
cagagtggcgcccagacgcagaagcacccgccgcctgtgaacttctcgcttttcatcccg
atcgtgcctggccctgaagaaggcggcgttcccggacaggcggttgatgtctctccagag
gtcggcgactcgaaaggctcgaaaggcctggcgagaaagacgaaggactccccagcgccc
agaagccgagtcagagcagacaaacgagaagaggcgtcgtctgccgtcgcgaagagtttg
gaaagcgaaccagcccacatgcgcgcgacgcgttgggtcctcggtccccatgaagagcag
agggtgctggtcaagttctgcgtcgaccagactggggtgtacgaaacggggctcgccttc
agcgtcgtcggcgactcgcagtcgctcttgcgcgtaggtgtgcgcgccacatgcagtgtg
ccgaaactctccatgagtccgaagcagctctttcggcaggttctccgggcaagaccctcg
gaacgcgaaggtctggtctgcaagcagttcatcgtcgacgagggtgtgtatgactttggc
ccgcttctcctcgggcggccctctgccccggcgaaaggtctttactcaaaactcggtgac
ggcgacagcgtcgatgctgtgaagcttcctgaagacctacagaaataccaagaatccatc
actctatgcaacatttcaccgttcgacacgaccgtccgctgtacgcttcagagtgcgagc
cctgcgcctgattctggggaccacacgggacggaagaaaggagcgagcaagggggcgctt
atccgagaaaatccgttctttgtttatccctcggaggtctccctcgaaggcaacagttgc
agcacagttcacctgtggtgctttccgaaaacggagggcgacgtgagagacaccctcgtt
ctctgggtcagggacaatccgacgcctgcagaaattccacttgtggctcgcggggcgctt
ccgaaggtcaccgtagacgctgactacctacagtttggcagggtcctcttcgggcattct
gtgagcagagccctcagcttgaagaatgcgtcgccgttgccggcacggtggtcgctgctg
aatgtcgacgcccttcagaagcttttcaaagtcggccccgacaccgagggcacactcgag
gctttcgaagagcttcagctgctcttcacgttttcgccgacgcagaaagccgccagtctc
caaacgcgagtttcgatccgaatcacagacgtcgacggaacggggcaggcgcaagaaacg
aaaaccatatcagtggatgcagacgcgtactggatcgacgtagcaacggactttggcggc
aaaggcaagacaatcgacatcggaaatgtccgcgtaggagagactgcggagttgccgctc
agcatcacgaacaaaggcaagttcccagtcaaatttgctttcagggtgaaatcgaaggtc
ctcagaagcattctgactttccatggacccactgcggacttggcgccaggcgagcaccgg
cgcatgtctctgcgatgctcgccgcagagagaaatggacttctgcgaagcggaagaagtc
ttcctcgacctccaggatgccgagagtggggccgttctgaatccggctctgccgccgttc
cctctctccctgcatgcagatttcaactatgtctctctcctcccagctcggggcatcaac
ttcggtcccaccgagagcgggaagacgcactcgctgcaatttgaagttctcaacgacggt
cgatttccctttgagtggctgctgcaagacgcagaccagctgtcgcggctttgctcggca
accgtcgagaatgcggggaaggctctgacggaggccgagtcgccggtccccgcgctcgga
ccgtcgccaaaggagacgcgcgccagagccggcgatcgcagcggtgccgctgcgggaggc
gcctccaaagctggggcgcctgggaagtcgagcaaatcgccaggaactcgacaaatgagt
tcctttgcccagtgggggcctttccgcctctcccccgtcaaaggccagctcgaaccggga
ggcaaagtgacagttgacgtccagtacagcgctcagggcgacgctaaccactctctcaaa
cttgctttgctggttcaaggagtgaaagtcgaaaggggagaagaagtcgtcataagcaac
gtcgggtgtctcggcgctctcacagccgagggaggcgaagggacaggagacgcgaaaggc
gagaaagcattacgcgaggttctctctgggtgcagtgggcctctcatccctgcagctgaa
tatattattcaagctcaaagttgcgttccagctatcgtaaccgaccctgaatgggtattt
gaggaacagtttcttgtctcgaacgctgaagaagcagcagtctggaacggcctgagaacc
acccccatgtaccttctggaggaaaagtgtctcctcttcgggtcggtcactcccaactcg
gacgtgaacaaggcagggattcaggcgcagattcgaattggaaatccaaagtccgtccct
gcagctgtctctctcgaaatcaagctttccaaagacacggacaaaagcctgctgtctcac
attctctcctctctcctcacgctcgcctcttctgtctccttctcccccctggtctcgcag
accaccgactccgagtccgtcttcgaggtgcagccgaagcacttgtcactcggccctcac
gagacgaaaacggccaccctcacttttcacccgtctgcacttcagcgctacgccgccgcg
tttcgtgcgtttgtaaatcgctctgcagcagatggcgggaacgccgctctcgccttcgac
gtcaggggagaaggaacactccccacagtctctctcgaggttgcgccgtccgacgctgca
ggctcagcgcatgccagtggcgagaagagcttcttcccgtctattgccatgggcaaagtc
gctgtggggaccaccgccacggcggtttgtctgttgaaaaactacggaaccattgcggcg
acagcgagatgtgagtggcccgccgccgatggaatcactgtcgagctgccccctgccgta
actctaaatcccggggactccaagacctttgcagttcacctcgttgctcaagccccagga
gagatcgactccagtttccgtatttacacggtctctaatccgtacgaggatgtgacttgt
cgggtgcggggaacgtgctatttggaggagtgtcgctggtcgacctcgccgtctaggtcg
tcgggcctcacgccgcccacctgcctccaaggctctcctggcccactgaacgcaaccagt
ggcgtccgcggctcaccctcagctgccgccggaacgggtgtgtctctgggcgagaggaca
gctgtctccttcgacgcggcgctgtcccctcggctacccgaaagacaaggcgaccagccg
gcgtctaccgtggacttcggcgatgtagcccctgacgaccgagtaagcagaacgctgttc
ttcgagaatacgacggacagcttcatgaagttcgaagttgtctcgccgctgcctccagat
ctcagaaaggtgcttcagatctcgcccatcgcaggcttcttggcgcctcgaggcgcccag
gaagtcacactcgtcttcacctccaaggagccggtagctgtctccgctgtgtgtgtgccc
tgtcgggcctggcgcctcaaggcttcgagttccacagccgcggctgcggtcgcgaagacc
aagtcgcgcgccaagtcggccgcttcggtccaggattcggagggaatcgaagaacacgac
ggccagttttatcagatggaaaatggaagagaaatcgacctgccgctcttcatttcagca
agatgcgacacacgccagtgtgaactggagtgccaggacattgtatttgaaagcacaatg
atgttcaagtccaaggaattcgtcttcactcttacaaatccagcgaaggtgactctcccg
ttcgagttccggtgggaagacacggacgcgttgctggacaatccctcgttttacgttctg
tctccttcgaagggcgtggtgcctccctcctcaaagatggacatctccctcgagttcact
cccacggaacttgctgtcttcaaacgcttcctagtctgctccttcccttcgctgccctat
ggagaggaaacaagaaaaatgaccgtcgacgccacagccgtcagacccatctgccacttc
gacttgccgccgtcggactaccgagacaggcgcgagcagacgaacctccccgctctcgac
cccaagatacaggtcgtcgaaatcgtgagcgtcggcattggagtaaaaaacacgaagagg
ttcttcgtcctcaatccctcgtcgtcggatctggactttgagtgggagcccctttcttcg
gactctgctcctcactctctcaaggcggacgcaggaggactggcttcctctcaggcctgc
agggacagagtcgcctctgcccgctgcgcctcaccgggtgctggaactcctcggaggact
gggttcctccctccagtcgaaggagttcgctgtgtgaatcttcgcgggcgaattgcagct
gggagaaaaaccgaagtcgttcttgagttcctccccaacaaaccaaagacgcaagaacgc
ctctggaagttctgcatcccgagcagaaagctcgaacagctttttctctttgtgggccgc
gtcaaagagccgcatgtcgcgctggattgctcgtccgtatgcttcaaccctgtccttctt
ggaggcaaagtcgaagaagtcgtcaacatccacaataaggaagatatccctctgtcgttc
gctttctctcggaaacaagccgagtccgaaaaaagtcctttgcctccgtgtctcgtcgtc
tccccgaggcacggagtgcttcctccgaactccgtgacgccggtgcgtctgaggttcaag
ccggaagacgagaaacctttcaagtgcagtcttctctgtcgagttcgacaaaaggtccga
cccctctcgctcggtgtcagaggcgctgggtactctgtcaagcacagcatggtgcttctg
aacgaagatgggagtatacggcaatttgcctcaggatcgcaaagtgcgtctctgctggac
tttggacctctgttgctcggacagacgcgtcgttaccttcttcagttgcaaaatgctgga
tctttcgacttccgcttccactggagtattcagagtgtcagcaccgtctcctgctctccc
agtctctctgtctcccccacagaaggcgtggttgagacgggaaggaactgcgaggtgaca
ctgacatacgcgccggcagagatcagcaagcacgaagagtatctgcttctttgctccatc
agtggaagcgatccgtatcgcatccgagcacaaggttcttgctcttctccaaaggtgtct
ttctccttttctagccacgacttcggcgcctttgtgcttccaccttctctgttcccggac
ctgggcagcgtcgtcgcgctgtcgtcgcccagttctggcggcagcgctatcagcgaccgt
gtggagttgaaaatcacgaacttagatcctcaccacgactgctttatttccacacccttc
gaaaaaagcaacgtccttgacgtccaactcgtcccgtgcagcatcggtcccggggagaag
atttcagtcaccctggtttttgcgccgaagcaagcgaagaactacagattcaaaatcccc
ttttccatcaacgaccgaaccacagcgcatgtcactgtcacaggcaaaggcattcccgct
agactggagctttcgccttcatcagacgagattcgctttgcgccgttaatcaaaggggag
tctgctgtcaagcacgtgcgtatcgtcaaccggacggaggcgagtctggagtttttcctt
ccagcttctccgaatttgagctctcgcggaatcagctggaagccgctgtcctcggaaacg
aaaccgttctcgcttcaccctcgccaagaactgccgttggaagtgtcgttcaaacccgcc
ttgtcgattccggagttttctcttcctctttttgccgaatgtctggtgaagcgaggaggt
ctgacgtatcgctttccttctcttctctgtcacatcgccgccaagtcgttcgaaaccgag
gtgcgcttgagtcagccgtcgctagcattcggaccaattgtggtgaattcttgggcaacg
caaatcgtgaagctgaccaatatcggggaactcttcatgcatttcaagttcaagacttcc
acgaaatactcgcaaatggtttccctctctccctccgagggtcttctgcatccccacgcc
gacgtccctatcgaggtcaccttccgacccacagaagtgacgcagaaacgaattgtcgtt
gatgatatcatttgcctgatcaaggcctctggcgcctccgccagcaacgtggagacgtcc
tctctttcgctcacagtgactgggcaaggtgtcgcgcagccgagcgattctgtccagacg
ctgcagttttcgacggcggtgcgcacgcagcagacaaagactttccaggtgaaaaattca
aaaaagtacgactggagtaccacgccgcttgtcgcctgcgagagtccgaaagacgccatg
tacttcttgtgctcgcctagcggaagagtcacgattcctgcaaatcaaaaggtaactttc
caagtgacctacagtccgctgaccatgacccgcgccagctcgtctgtgcgcgagggaact
ctcagtgcggaggaggtggacggcgtgaacagaaaagagcaaagagaaagaggcgacggc
gcctgtaatgggcatctggcggacaaggacaaccacccccggctgccgctgtttcatgcg
gcatcggtcttcatccccctacccgacggggaagcagccacatgcagattcatcggccaa
gccaccgaaccgacagtggagcaagtggttgacgcatcaatcgtctgtcgcgagaagcag
attcaggcgataaaaatccggaattggattcctgtaaaacagaagttcgacgtcgcctac
acaatcactcagtgcacaggcgatacgcctccgcagattcaggcccctgaccgattcgag
ttgcctgcgtctcaagcgcgcgaataccggtttctcgcctcagctttcaagccgtgtgcc
gcggttgtccagtttcgttttacgagtcgagaaaaagcagatttctacctcgctgaggcg
cggctgactttcacggatcccgagacggtggggacgatcgctctcgagacgactgtgcgg
cagctcgcgaaaaccaaggtgttggtcgaaaacccatccacgagaaaagccgtcttccag
tgtcaaagcaacgtggccgacgtctgcttctcgccgtcgccactcgaggttccgccgggg
gcgaccggtgcgttggaagtctcgctgcgtgcgaacgtctccggggcgggtgagggaaca
atcgtcctcaccagtgacgaactgggcacctacaagtacctgctaaagtactctgtgtct
gctggtgaaatcgagaaacacgccacgttcagcgccccgctggggaaggaagtttccgag
actctccggtttctccacttcgccaagaaaccgacgacttacctcgcgacgatcgacttt
gcccccgacgagacgcgcggaggcggccgcagcaaagcgagtgggagcgtggagaacttt
ttcctagaaaacaaaagtgtcgcggtttctggagatgtggagaacagaggcaccgagttc
gccgtcggcgtccggttcgcgccgtccaaacttgcagaaacgaaggcgacgctcgttctg
cggagcgccgaaggattcgaatacaaggctcttctcattggtcgagcgcaaccgccgcaa
ccgcaaggcccgtttcgcctggggaagggaaaatgcatcaacatcgacttcaggaatccc
tttgaaacacagacggaattcagtctccaagtcgaccggccgtgtttctctgtggagaag
aaagtggtgaaactcgaggcaaggaaatcgactacgatcagcgttcaggtgaagcccgac
gcgcgcgatgcaggacgcctcatcgtcactgccgacggcatccctccgtggatcttctac
ctcaaggctgactag

DBGET integrated database retrieval system