KEGG   Toxoplasma gondii: TGME49_215590Help
Entry
TGME49_215590     CDS       T01093                                 

Definition
(RefSeq) flavoprotein subunit of succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tgo  Toxoplasma gondii
Pathway
tgo00020  Citrate cycle (TCA cycle)
tgo00190  Oxidative phosphorylation
tgo01100  Metabolic pathways
tgo01110  Biosynthesis of secondary metabolites
tgo01130  Biosynthesis of antibiotics
tgo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TGME49_215590
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TGME49_215590
Enzymes [BR:tgo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TGME49_215590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 7897057
NCBI-ProteinID: XP_002370878
UniProt: A0A125YI83
LinkDB All DBs
Position
X:complement(join(7032191..7032274,7032882..7032953,7033428..7033548,7033861..7033982,7034472..7034557,7034883..7034915,7035243..7035395,7035740..7035856,7036490..7036603,7036861..7036934,7037333..7037408,7037692..7037764,7038309..7038372,7038882..7039077,7039584..7039662,7040094..7040195,7040533..7040592,7040727..7040824,7041335..7041424,7041786..7041981))
Genome map
AA seq 669 aa AA seqDB search
MHASASLTQALRPYARRPLSSALSRSSLSPALAAGVARGLNAAQPQATGPSFVQQKRFFT
NVKKPAYRVIDHEYDAIVVGAGGAGLRAAFGLASAGIKTACLSKLFPTRSHTVAAQGGIN
AALGNMTEDDWRWHAYDTVKGSDWLGDQDAIQHMCREAPKVVRELESYGLPFSRTEDGRI
YQRAFGGQSLRFGKGGQAYRCAAAADRTGHAMLHSLYGQSLAHDCKFFVEYFALDLMMSG
ENDERKCHGVVAMCMEDGSIHRFAAKHTVLATGGYGRAYQSCTSAHTCTGDGGGMVSRAG
LPLEDLEFVQFHPTGIFPAGCLITEGCRGEGGILRNGQGEAFMARYAPTAKDLASRDVVS
RSMTIEIREGRGCGPNRDHMHLDLTHLPPATLHERLPGITETAKIFAGVNAEKEPIPVLP
TVHYNMGGIPTNWRAQVLTTSRSKAGGPDKIVQGLYAAGEAACASVHGANRLGANSLLDL
VVFGREAARTIADECKKDASAPSLPPNAGEETLAMVDRLRHSNGPLTTAQIRQRMQKTMQ
DHAAVFRTGAVLREGVEMMKDVAKSFADVGVKDRSLSWNTDLIETLELQNLLTQAVQTIV
GAEARKESRGAHAREDFKERDDKNWMKHTLSWQTHREVEKAEFPLTYRQVISQPLDNEME
HIPPAKRVY
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcgtcggcatccctcacccaggcgctgcggccctacgcgcgtcgtcctctctcc
tctgctctctctcgatcctcgctttctccagctctcgcagctggcgtagctcgtggactc
aatgccgcgcagccgcaggcgacaggaccttcttttgtgcagcagaaacgcttcttcacg
aatgtaaagaaacctgcctaccgagtcatcgaccatgagtatgatgcaatcgtcgtcgga
gcaggcggcgctggtctccgagccgccttcggcctcgcgtctgcaggaatcaagacggcc
tgcctttcgaagctcttcccgacgcgctcacacactgtcgctgcccagggtggcatcaac
gcagctctcggcaacatgacggaggacgactggcgctggcatgcgtacgacacggtcaag
gggtcggactggctcggtgaccaggacgccatccaacatatgtgccgagaggctccgaaa
gttgttcgggagctcgagtcctacggtctcccgttctcccgcactgaagacggacgcatc
taccagcgtgcattcggaggacagtctctgaggttcggtaaaggcggccaggcgtatcgc
tgcgccgctgcggcagatcggaccggccatgcgatgctgcactcgttgtacggacagagt
ctggcccacgactgcaagtttttcgtggaatactttgccctggatttgatgatgagcgga
gagaacgacgaacgcaaatgtcacggagttgtcgcgatgtgcatggaggacgggagcatc
caccgattcgcggcgaagcacacggtcctcgccactggaggatacggccgcgcctaccag
tcttgcacctccgctcacacctgcactggagacggcggcgggatggtctctcgcgctgga
ttgcctcttgaagacttggaattcgtccagttccaccccaccggaattttccccgccggc
tgtctcatcaccgagggatgccgcggagagggtggcattctccgcaatggccaaggcgaa
gctttcatggcccggtacgcccccacggcgaaggatctagcaagccgcgatgtcgtgtca
cgatccatgaccatcgaaatccgagaaggccgcggctgtgggcccaatcgtgaccacatg
catttggatttgacgcacttgccgccggcgactctccacgagcgtcttcctggaatcacc
gaaaccgcgaaaattttcgcaggagtcaacgcagaaaaagaaccgattccagtgctgcca
acggtccactacaacatggggggcatcccaaccaactggcgcgcgcaggtgctcaccacc
tcccgctctaaagctggcggccccgacaagatcgttcaaggcctctacgccgcaggcgag
gctgcatgcgcttccgtgcatggcgccaatcgcctcggtgcaaattcgcttttggacctt
gtcgtttttggacgcgaagctgcgcgcacaatcgctgacgaatgcaagaaagacgcctcg
gcgccgtcgctgcctccgaacgcgggagaggagacacttgccatggtcgatcggctgagg
cactccaacggaccgttgacgacggcgcaaatccgtcagcgcatgcagaagaccatgcag
gaccatgcggctgtcttccgaacgggtgccgtcctgcgagaaggcgtggagatgatgaag
gacgttgccaagagcttcgctgacgtcggcgtaaaggaccgatcgctctcgtggaacaca
gatttgatcgagaccttggagctacaaaacctcctgacgcaagccgtccagacgatcgtc
ggtgcagaggcgcgcaaggaaagccgcggcgcgcatgcgcgcgaagatttcaaggagcgt
gacgacaagaactggatgaaacacacgttgtcttggcaaacgcaccgggaagtggagaaa
gcagagttccccctgacgtaccgccaggtgatctcgcagcctcttgacaacgaaatggag
cacattccgccggcgaagcgcgtgtactga

DBGET integrated database retrieval system