KEGG   Toxoplasma gondii: TGME49_278320Help
Entry
TGME49_278320     CDS       T01093                                 

Definition
(RefSeq) Toxoplasma gondii family A protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 7900394
NCBI-ProteinID: XP_002370535
UniProt: S8ESU7
LinkDB All DBs
Position
XII:complement(6159257..6160339)
Genome map
AA seq 360 aa AA seqDB search
MARQLFRVVCLTLVTGTALSCAASEKEPTATADFTATIPKTGLERSVEKVFFLGPSNTLQ
VIDQTGAAVYLPEKSANTQDSSSKPYSVAYRFENGACDFTKTVEFKDIFPDYTTAVWDQE
QKDSATSGGGSAEKVVKYRFTNPPAEYLGEGLSFCVRFKTVLASGSGSPTKTSTSSTSDG
GSDAQTPGDETTEEESPQEQGPSQGPVGGSSPGDGSQGPSEEVGQQLPSVGEGEKEEENS
DIRASPATPGVVAGGADSPAVPREPSAHNADKDQGSPSLFNPQGRVTEEQGRLDQDEGHE
GDDATQEPSGVIVRRLDAPALVQDAYLTIVVHSAAWSSASGIGASSGILITVTITLLQIW
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggcagctatttcgagtcgtgtgtctaacgctggtcacgggcactgccttgtcc
tgtgctgcctccgaaaaagaaccaacggccactgccgacttcaccgccactattccgaaa
acgggacttgagaggagcgtggagaaagtcttttttctcggaccatcgaacacgctccag
gtcattgaccagaccggcgctgcagtctatttgccagaaaagagcgccaacacacaagat
tcttcctctaaaccctacagtgtcgcttatcgctttgagaatggggcgtgcgacttcacc
aaaactgtcgaattcaaggacatatttccagactacacgacggcagtatgggaccaggaa
cagaaggactcggcgacgagtggaggtggatctgcagaaaaggttgtgaagtacaggttt
acgaatcctccggctgaatacttgggtgaagggttgagcttttgtgtgcggttcaaaaca
gttcttgcgtctggttcgggttcaccaacaaagacctcaacttcgtcgacgtctgatggt
ggctccgacgcacagacacctggcgatgagacaacggaggaagaaagtcctcaagaacag
ggtcctagccaagggccggttggtggtagctcgccaggagacgggtctcaaggcccctcg
gaagaagttggccaacaattgccttccgttggagaaggggagaaggaagaagaaaattca
gatattcgtgcgtctcccgctacgcccggcgttgtcgcgggtggcgcggacagtcctgcc
gtaccacgggaaccatcagctcataacgccgataaagatcaaggctctccctctctgttc
aaccctcagggtagagtcacagaagaacaagggcggcttgaccaggatgaaggccatgaa
ggtgatgacgccactcaagaacccagcggcgtcatcgtgaggcggctggatgcaccagcg
ttagtgcaagatgcatacttgactattgtagtgcactccgcagcctggagctctgcaagt
ggaataggtgcatcgtccggtattctgatcactgtgacaatcacgctgttgcagatatgg
taa

DBGET integrated database retrieval system