KEGG   Toxoplasma gondii: TGME49_283490Help
Entry
TGME49_283490     CDS       T01093                                 

Definition
(RefSeq) Alpha-amylase AMY3, putative
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amyl_C2 fn3 hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 7896195
NCBI-ProteinID: XP_018637755
UniProt: A0A125YXT4
LinkDB All DBs
Position
V:complement(join(3122062..3122227,3122345..3122419,3122592..3122677,3123066..3123158,3124191..3124400,3124625..3124774,3124878..3125109,3125232..3125756,3126420..3126571))
Genome map
AA seq 562 aa AA seqDB search
MGLTTYRFHVKAFNYLEQEGAASEKIAVRTGEPGKPSAPCELACTGHGQKSIQITWKAPA
DHGGAPIRYYRIYKNGHHLAFVSALAGTIPSFVDDTVTPTELCTYRVSAWHNLPPAGCDE
TRIPMKPSADPFDWFKASVGRSPIEGLLSEPLGVKADDMLQMPRLNDAKPHILLQGFNWV
SSRNPYGWYRVVKNKLPDIKRLGASIIWLPPPTESVAAEGYMPTRWYNLNSKYGSQEDLK
TLIRTAADDYNLSCCVDVVVNHRSATKQDKRGHWTVFEDPHWGPWAIVCNNLQGYKGEGG
FDTGTRVDCAPDLDHTNKRVQEDVKKWLSWLVREIGYTSIRLDMAGGYGVAFQKSYIDSV
DRPFTVGEYWDGCTETLANYVRAGQGSLAAFDFALYYVLKRCVESQHFHELNSCGRINGL
IGLEPQLAVTFIENHDTDHLDYCTTFGGGNLDAVLQGYAFLLTHPGVPSVYWNHFSDYGP
YCKEKLQELCDVRVGQGIHSTSGIFMSRTEEGLYAAYISSQSCYCRPDTANVAMKIGFKD
WVPEGHRWKIATFGKNYCVWTR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgacaacttaccgcttccatgtaaaggccttcaactatcttgaacaagagggc
gctgcgagtgaaaaaatcgcagtgcggacaggcgaaccgggaaaaccctcagctccctgt
gagcttgcttgcacggggcacggacaaaagagcatccagataacatggaaggcgccggct
gatcatggaggcgctcccattagatactatcggatctacaaaaatggacaccacctcgca
tttgtgtccgcccttgccggaaccattccttctttcgtggacgacactgttactccgaca
gaattatgtacatatcgggtatcagcgtggcataatctgccgcccgcaggctgtgacgaa
acacgcatcccgatgaaaccgtctgcagacccctttgactggttcaaagcttctgttggc
cgctcacccattgagggtcttctatccgaacccctaggagtcaaggcagacgacatgctt
caaatgcctcgtctgaacgatgcaaagccacatattctgcttcagggatttaattgggtg
tcatcgcgtaacccatacggatggtatagagttgtcaagaataaattgccagatataaag
cggcttggtgcaagtatcatttggctgccgcctcccacagaaagcgtcgctgccgaagga
tacatgccaaccagatggtacaacttgaacagtaaatatggcagccaggaggatctcaag
acactgataagaacagcggccgacgactataatctctcttgctgcgtggacgtcgtggtg
aaccaccgtagcgccactaaacaagacaaacgcgggcactggactgtttttgaagatcca
cattggggcccatgggccatcgtttgtaacaaccttcaaggctataagggtgaaggaggt
ttcgacacgggtacacgggtagactgcgcccctgatttggatcacactaacaaacgagta
caggaagacgtgaaaaagtggctctcctggttggttagagagattggatacacttcgatc
cgcctggatatggcaggcggttacggagtcgcattccagaagtcgtatattgacagcgtc
gacaggcccttcactgtaggcgaatactgggatggatgcactgagacgctggctaactat
gttagagctggtcaaggatcattggccgccttcgacttcgccctctactacgtactcaaa
cggtgcgtggagtctcaacacttccacgaattgaactcatgtgggcgtatcaacgggctc
attggattggaacctcaactagcagttacatttatcgaaaaccatgatacggatcactta
gactactgcactacattcggaggggggaacctcgacgctgtcctgcagggatacgcgttt
ttactgactcatccaggagtgcctagtgtgtactggaaccacttttccgactatggacct
tactgcaaggagaaacttcaagaattatgcgacgttcgagtgggccagggtattcatagt
acaagcggcattttcatgtcaaggacagaagaaggcctgtacgcggcgtatatttcgtcc
cagtcttgctattgccgcccagatacggccaatgttgcaatgaagataggcttcaaggac
tgggtaccagagggacatagatggaagatcgccacctttggcaagaattactgtgtgtgg
acccgatga

DBGET integrated database retrieval system