KEGG   Toxoplasma gondii: TGME49_288700Help
Entry
TGME49_288700     CDS       T01093                                 

Definition
(RefSeq) RecF/RecN/SMC N terminal domain-containing protein
  KO
K06636  structural maintenance of chromosome 1
Organism
tgo  Toxoplasma gondii
Brite
KEGG Orthology (KO) [BR:tgo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tgo03036]
    TGME49_288700
Chromosome and associated proteins [BR:tgo03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    TGME49_288700
  Meiosis-specific sister chromatid cohesion proteins
    TGME49_288700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_23 AAA_15 AAA_29 AAA ABC_tran
Motif
Other DBs
NCBI-GeneID: 7898084
NCBI-ProteinID: XP_002368310
UniProt: S8F323
LinkDB All DBs
Position
IX:join(2683389..2684181,2684804..2684993,2685463..2685747,2685983..2686148,2686834..2687067,2688176..2688514,2689144..2689308,2689879..2690151,2690448..2690666,2691189..2691449,2692271..2692486,2693227..2693616,2694372..2694860,2695219..2695646,2696371..2696625,2697383..2697596)
Genome map
AA seq 1638 aa AA seqDB search
MRKMKRTRTIALAATQALLSESRENAPSRKTLQDASPGRDSRTELESERDGECPASVADA
PSEVSMAEVTMSDGEESGLNWKRNDAHSSSDSPAASRPFVSTPGGAPFELVSPATPQQRE
LDWRSESRNGETSHDRVVAKDSRNEEPQLALVPRSEGSAAPGSTSRRRRAEAQGPRLMEL
MEQALASRRPGMPFLGRGIWSKDSIAAPDPFSATLDFGALFRRGTQGGRLCLRWVVLENF
KSYKGTHVVGPLYGSVAVIGPNGAGKSNLTDAICFALGVNAKQLRCTRLVELIHASEAKA
PERSGSETRKEVVDGDLHADDSSGVEKKSASVTLHFVRGPAPAASPLPEKISFTRRVSHS
GDCSYLLDGASVPLEDYRGALRRHCGCTVHTLQAMLIFQGHIDALATKSPQGLAGLVEEI
SGSAELAEPYQEAQKAVAEAREEARRLLFRRSQLEQDMKVLKKQKGEADAYEKEQQLQKE
QQDELLLFRLLVAETLRAEEEANEHRAHVEEAEEKEKLGALLAEAQQADRGRVGALLRVQ
KAKDSLANFTQRSNQLRGAYLATMERLKFLETTREAAAREKAVADAQREDLNAYEEALKT
QLIRVAQKRREAEAQLEAEQAKEAAALLPENRKLLETLEDEWEEQHALQQHSIRSHQEQL
KALRNALDLLQREEREVQRSVETVQDLHGEAATKAADVAETLQRLLAQAHDAKESLQDLR
TLASTSQEQRESLLRLQATLHEELAQERSLQLDAKRLLQEKEVCKLLQKHVSHAGVHGTA
LECCRPASKRLTVAVAAALGPKASSLLVDSHALALKCIEYLKTARLGSCEFLPIETLRQK
QLRGGGEDTEEEEGGTLLPPPPADALPPGCRWAVDCVSFEDRFRHVYQFLLSDCLIVPSL
AVARELRFGRAHASVEKYRLVTLDGEKLQRGGVIAFDLGGLTGRLAARWEAQQQDRLLER
VEKVREQLQALEHAETTTAERLQQRTAQFNLLHRQCVQLQAKARVWEEQAEEKQEKLHRM
QKQLQELREREAARKQELTAKQQALDEIHATVLQQQQRHFAQLDAAVGRRHVLAEHRRRR
QRVEALKAELTGLHAQETQLQAELADCGDRLAQLQRSTEAKGEEDEKEKKEDERRLLKQL
ELTERDVEDADSKREAAAAEARDAQQDLQTHEKNLQKIRERVEASKLEQQRLSREAAAAS
GRQRQQTMESMQILRQADQQGMRVPLAAGTWRNVRMWVYREEKRRAFLDSSSEDEEPQSV
DAPSEERGHSKKSKDAAESPRRTGDIAGRRRSDASERDAPEGEGTGEGEVRDRRREQERP
DEDEKLFVIDFSKLAAEKREFISQHKDTPARLLEAAATQEAELLRRGAHLRSLFPNLKVG
EKEKKTREQLTEISAELERVQRVSRAAAARLADLQRERNARFAVCFHHCRVAVDVFFREL
TTTTFGKDAGLDDATSGFAKVGGRAYLDLERPRGDREDDAFAGGVSLLCMPPGKRLLPLH
LLSGGERLVAALSLVLALLSFTPHLPFLLFDEVDAPLDAHRRQALARLLRRLPSQAGLQV
LFISLKDKMFSTADLLVGVAKAPRLGCSRCFFLDLLPYRSRPSLSSRSRRIATDAENEED
SSLQREGAKHLLASENAE
NT seq 4917 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaaatgaagcgaacgcgcaccatcgcgctcgcggcgacgcaggcgctgctgtcc
gagtcgcgggaaaacgcgccgtctcggaagactctgcaagacgcgtcaccgggtcgagac
tcgcggacggagctggagtctgagcgcgacggcgagtgccccgcttccgttgcagacgcc
ccgtcagaagtttctatggcggaagtgaccatgtccgacggcgaagaaagtgggctgaac
tggaagcgcaacgacgcacacagttccagtgactctccagcagccagtcgcccgtttgtc
tcgacaccaggcggagcgccgttcgagctggtttcccccgcgactccgcagcagcgggag
ttggactggcgttcagagagcagaaatggcgagactagccacgatcgagtcgttgcgaaa
gactcgagaaacgaagagccgcaactggcattggtgcctcgcagcgaaggctctgcggcg
ccaggcagcacctcccgacgccgaagagccgaggcccagggtccccggctgatggagctc
atggagcaagcgctcgcgagtcgccgacctggcatgcctttcctcggcagaggcatctgg
tccaaagacagcatcgctgctcccgatccgttttccgccacgctcgatttcggcgccctc
ttccggagaggcacacaggggggtcgtctgtgtctccgctgggtggtccttgaaaacttc
aaaagctacaaaggcacccatgtggtgggacccctctatgggtccgtcgctgtcatcggc
ccaaatggcgcaggaaaaagcaacttaaccgacgcaatctgcttcgccttgggcgtcaac
gccaagcagctgcggtgcactcgtctcgtcgagttgattcacgcaagtgaggccaaggcc
ccagagcgttcaggctcggagaccagaaaggaggtagtggacggagacttgcatgcagac
gacagttctggcgtcgagaaaaaaagcgcgtcggtcacgctccactttgttcggggacct
gcgcccgctgcttctccgctgccagaaaagatatccttcactcggcgagtcagccactct
ggcgactgcagctacctgctagacggcgcctcggtcccgctcgaggactaccgcggcgcg
ctccggagacactgcggctgcactgtacatacactccaggcaatgctcatcttccagggg
catatcgatgccctggcgacgaagagtccgcaaggcctcgcgggcctcgtcgaggaaatc
tctgggagcgccgaactggcggagccgtaccaggaggctcagaaggcggtggcggaggcc
cgcgaggaggcgcgtcgccttctctttcgccgttctcagctcgagcaagacatgaaagtg
ttgaagaagcagaaaggcgaggcagatgcatatgaaaaggagcagcaactccagaaggag
cagcaggacgagcttctcctcttccgccttctggtcgcggagacgctgcgggcggaagag
gaagcaaacgagcatcgcgcacatgtagaagaggcggaagaaaaggagaaacttggcgcg
ctcctcgcagaggcccagcaggcagaccgcggcagagttggcgcgctcctgcgcgtccaa
aaagccaaggactctctcgcgaacttcacgcaacgcagcaatcagttgcgaggggcgtac
cttgcgactatggagcgactgaagttcttggagacgacgcgagaagctgctgcgcgcgag
aaggcagtggcggacgcgcagcgggaggacttgaacgcctacgaagaggctctgaagacg
caacttattcgggtggcgcaaaagagacgcgaagccgaggcacagctggaggcagagcag
gcgaaggaggccgccgccttgctaccggaaaaccggaaacttctggagacgctcgaagac
gaatgggaggaacagcatgcgcttcagcagcatagcatccgaagccaccaggagcaactc
aaggccctccgaaatgcgctcgacctgctgcagcgcgaggagcgggaagtgcagcgcagt
gtcgagacagtccaagatctgcacggagaggcggcaacgaaggccgcagacgtcgcggag
actctccagcggcttctcgcccaggcgcacgatgcgaaggaaagtcttcaagatctgcga
accctcgcctctacaagtcaggagcagcgggagtcgctgctgcgactgcaggcgacgctg
cacgaagagctggctcaggagcgcagcctgcagctggacgcgaagcgcctgttgcaggag
aaggaagtctgtaagcttctgcagaagcacgtgtcgcatgcaggcgttcatggcaccgcc
ctggagtgctgcagacccgcaagcaaacgcctgacggtggccgtcgccgcagcgctgggt
ccgaaggccagcagcctcctcgtggactcgcacgctctcgcgctgaaatgcattgagtac
ttgaagactgcacgcctggggagttgcgagtttctgcctatcgagacactccgacagaag
caactcagaggaggaggcgaagacacagaggaggaggaaggagggacccttctgccgccg
ccgcctgcagacgcgctgccgcccggctgccgctgggcagtggactgcgtctccttcgaa
gaccgctttcgacatgtctaccagtttttgctgtcggactgtctcatcgtgccttcgctg
gccgtggcgcgggagctgcggttcggccgcgcgcatgcgtctgtggagaagtatcggctt
gtcactctggacggagaaaagctgcagagaggcggcgtcattgccttcgacctggggggt
ctcacagggcggctggccgcgcgctgggaggcgcagcagcaggaccgacttctcgagcgc
gtcgagaaagtcagggagcagctccaggctctcgaacacgctgagacgacgacggcggag
cgcctgcaacagcgcacagcgcagttcaacctcctccaccggcagtgcgtgcagctgcag
gcgaaggcgcgcgtatgggaggaacaggcggaagaaaaacaagaaaaattgcatcgcatg
cagaagcaactgcaggagctccgcgaacgcgaggcagctcggaaacaagaactcactgcc
aagcaacaggcgctcgacgaaatccacgcgaccgtgttgcagcagcagcagcggcatttt
gcccagctggacgcggcggttgggcgcaggcacgtcctcgcagaacatcggcgtcgccgg
cagcgcgtggaagctctgaaggccgagctgacgggactgcatgcgcaggagactcagctg
caggcagagctcgcggactgcggcgaccgcctggcgcagctgcaacgcagcaccgaggcg
aagggtgaagaagacgaaaaagaaaagaaagaagacgagaggcgcctgctgaagcaactc
gagctcaccgagcgcgacgtcgaagacgcagacagcaaacgggaggcggcagctgcagag
gccagagacgcccagcaagaccttcagacacacgagaaaaacttgcaaaagattcgggag
cgcgtggaggccagcaagctcgagcagcagcggctgtctcgagaggccgcggcggcgtcg
gggaggcagagacagcagacgatggagagcatgcagattcttcgtcaggctgaccagcaa
ggcatgcgagtccctctcgctgcaggcacctggcggaacgtccgcatgtgggtctacaga
gaagagaaacgaagagctttcctggactcttcgagtgaagacgaagagccgcaaagcgtt
gacgcgccgagcgaagagagaggtcattcgaagaagagcaaagacgcagcagagtcgccg
agaaggacgggtgatattgcgggaaggcgacgcagcgacgcgagcgagagagacgcgcct
gaaggcgagggaactggagaaggcgaagtccgcgaccgacggagagaacaagagcgtccg
gacgaagacgagaaactctttgtgattgatttctcgaaactcgctgcagagaaacgcgag
tttatttcacaacacaaagacaccccggcgcggctgttggaggcggcggcgacccaggag
gcagagctgctgcggcgcggagcgcacctgcggtctctgtttccgaatttgaaggttgga
gagaaggagaagaagactcgcgaacagctgacagagatctccgcagaactcgagagagtc
cagcgcgtgagcagagcagcggcggcccggctggcggatctacagcgcgagcgcaacgcg
cggtttgcggtgtgtttccaccactgcagagtcgcggttgacgtcttctttcgcgaatta
accaccacgacctttggcaaagatgcaggcctcgacgacgcgacgtccggcttcgcgaaa
gtcggcggacgcgcctacctggacctagagagacctcgcggagaccgggaagacgacgcg
ttcgcgggcggcgtctcgctgttgtgcatgcctcccgggaagcgtttgctgcctctgcat
ctgttgagtgggggagagcgtttggtggctgcgctgtcgctggtgctcgcgcttctctcg
tttactccgcatttacctttcctactttttgacgaagtcgacgcaccgctcgacgcccat
cggcgccaggccctggcgcgtctcctgcgccgccttccgtcgcaggccggcctccaggtt
ctcttcatctccctcaaagacaagatgttttcaaccgcagatttgctcgtcggggtggcg
aaggccccgcgcctggggtgctcgcgctgtttcttcctcgacctcctgccctatcgatct
cgtccttcgctttcttctcgctcgcgcagaattgccacagacgccgaaaacgaggaagac
tcgagtctccagagagaaggcgccaagcacttactggcctccgagaatgcggagtag

DBGET integrated database retrieval system