KEGG   Toxoplasma gondii: TGME49_298020Help
Entry
TGME49_298020     CDS       T01093                                 

Definition
(RefSeq) DEAD-family helicase
  KO
K12858  ATP-dependent RNA helicase DDX23/PRP28 [EC:3.6.4.13]
Organism
tgo  Toxoplasma gondii
Pathway
tgo03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tgo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    TGME49_298020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tgo03041]
    TGME49_298020
Enzymes [BR:tgo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     TGME49_298020
Spliceosome [BR:tgo03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    TGME49_298020
 Complex C
   U5 SnRNP specific factors
    TGME49_298020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C
Motif
Other DBs
NCBI-GeneID: 7901483
NCBI-ProteinID: XP_002371219
UniProt: S8GUE5
LinkDB All DBs
Position
II:join(2198046..2199277,2199730..2199814,2200434..2200559,2200800..2200875,2201259..2201443,2201649..2201734,2202361..2202465,2202980..2203048,2203937..2204156,2204493..2204664,2205427..2205538,2205855..2205974,2206225..2206325,2206855..2206958,2207425..2207513,2207928..2208042,2208321..2208418,2208913..2208976,2209422..2209545,2209957..2210150)
Genome map
AA seq 1158 aa AA seqDB search
MSPELGREHGNGDTAEVSPVSVSGSEGAAEPDNARKESQRSAPEAGSQEEDDREEGEVRS
SGSSDVDNGDRAAEARGGEQENEATRGRKRVLPAAGKEPPSVRRAVAVSALPAPRFSSRL
PPCRPTAPSSSKKFPDGHGDIEGGAHSGASHRKQDEASVVAAVSSPPLACGVTSALPKRT
FSSSTLDLQPSAGLARSPVSALSAAKQEASICPRSSRYSREEETRVGGRHVRDGDRRTRE
DDRRRTDDDSRDGRDDRRTREDDRRRTDDDSRDGRDDRRTREDDRRRTDDDSRDGRDDRR
TREDDRRRTDDDSRNGRDDRRTREDDRRHRDEARTEGREDRRGRENDRRGREEDRVRSDG
KDEDREGSGGRERDSRSGRDAVGTKRGDSARQTKEDGEDEQDKSRPASWTSVLRAPERNS
IRSLEDVLTKQKTEEQPTRIMFLTKKQREQQRAADERRQMEMEKKKERQLLQNRKNFLMQ
QEIEKEREMKEKLKQREMEKIKEEQERRLRAVRGHAGTSSRSKAEEEREAKREAEGKKGG
SSGRARESSLADLRLLNLPEQELRARQQERELEQIRNHYLGMRTEKKKIQKPSEKFRNIF
NFEWNDAEDTCKGDNNPLYQERMEPQLLFGRGFRAGMDIREQRKQNNFYDELVKRRQEHQ
KAEASRGAAEAAAAATEAVRAARDAQASRLREKEDAEDNRGHWTTKKREEMNERDWRIFR
EDFEIYIKGGRVPPPIRTWAESALPWELIEAVKHANYDRPTPIQMQAIPIALEQRDLIGI
AETGSGKTAAFVLPMLTYVKGLPPLNEDTGQDGPYALILAPSRELALQIDEETQKFASFC
KCQTVAVVGGRSAETQAFQLRRGAEIVIGTPGRVKDCLEKAYTVLNQCNYVVLDEADRMI
DMGFEEIVNFILDQIPTSNLKSNDEALILQQEMQAKAGHRLYRLTQMFSATMPPAVERLA
RKYLRQPSYISIGDPGAGKRAIEQRVEFVPEARKKQRLQDVLENATPPVMVFVNQKKSAD
ALAKVLGKLGYSACSLHGGKAQENREAALSSFKEGSHDVLVATDVAGRGIDVEGVQLVVN
FDMPKDIEAYTHRIGRTGRAGRKGLAISFLTEEDSGIFYDLKQLLVSTNNIVPLELAHHP
AAKAKGGDKNLIKPIWFN
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctgagctggggagagagcacgggaacggagacacggcggaggtgtctcctgtc
tccgtttcgggctccgaaggtgcggcggagcccgacaacgcgcggaaggaatcgcagcga
tcggctccggaggcgggaagccaagaggaggacgacagagaagaaggtgaagttcgcagc
agcggctcttcagacgtcgacaacggcgacagggcggcagaagcgcgcggtggagaacaa
gagaacgaggccacccgaggacggaagcgggtgttgcctgcagccggaaaagagccaccc
tctgtgcggagagctgtcgcggtctctgccctgccggcgcctcgcttctcgtccagactg
cctccttgtcgccccaccgcgccgtcgtcctccaagaagttccccgatggccacggagac
atcgaaggcggcgctcacagcggggcgtctcataggaagcaggacgaagcgagtgtcgtc
gccgccgtgtcgtcgcctccgctagcttgcggagtcacatccgcactgccgaaacgcacc
ttttcttcctcaactctcgatctgcagccgtcggcaggccttgcgcgttcgccggtttct
gcgttgtctgcggcgaagcaggaggcttcgatctgcccgcgctcctccagatactccaga
gaggaggagaccagggtcgggggtcgacatgtgagggacggggacagacggacgcgagag
gacgatcgcaggcgaacagacgatgatagcagagacggaagagacgaccgacggacgcga
gaggacgaccgcaggcgaacagacgatgatagcagagacggaagagacgaccgacggacg
cgagaggacgaccgcaggcgaacagacgatgatagcagagacggaagagacgaccgacgg
acgcgagaggacgaccgcaggcgaacagacgatgatagcagaaacggaagagacgacaga
cggacgcgagaggacgaccgcaggcatcgcgacgaggcccggacggaggggagagaagac
agacgggggcgggaaaacgaccgaagaggaagggaagaagatcgagttcgaagcgacgga
aaagacgaagacagagagggaagcggaggacgagaaagagacagccggagtggcagagac
gctgtaggcaccaaaagaggagacagcgcgcgacagactaaagaagacggagaggacgaa
caggacaaatcccgaccggcgtcctggaccagcgttttgagggctcctgaacgcaatagt
attcgctctctcgaggacgttttgacgaagcagaaaacagaggaacaacccacgcgcatc
atgtttttgacgaagaaacagagagagcagcaacgagccgcggatgaacggcgtcaaatg
gaaatggagaagaagaaggaacggcagctgctgcaaaaccgaaagaatttcctgatgcaa
caagaaatcgagaaagagcgggagatgaaggagaagctgaagcagcgcgagatggagaaa
atcaaggaagaacaagagaggcgcctacgagcggtgagaggacacgccggtacctcgtct
cgtagcaaggcagaagaagaacgcgaggcgaagcgcgaagcagaaggcaagaaaggcggt
tcttctgggcgtgcgcgcgaaagcagcttggctgatctgcgacttctcaatctccccgag
caagagttacgagcgaggcaacaggagcgagagctcgaacaaattcgaaatcattacctc
gggatgcggacggagaagaagaagatccagaaaccgtcggaaaagttcaggaacattttt
aacttcgagtggaatgacgcagaagacacatgcaaaggcgacaacaacccgctgtaccag
gagagaatggagccacagctgctctttggacgcgggtttcgagcgggcatggatatccga
gagcagcgcaaacaaaacaatttctacgacgaactcgtgaaacggcggcaagaacaccag
aaggctgaagcatctcgtggagctgctgaagccgctgcagctgccacggaggccgtgagg
gcagcgagagatgcgcaggcctcgcgcctgcgtgagaaggaagatgcagaggacaatcgc
ggccactggacgacgaagaagcgggaggaaatgaacgagagagactggagaattttcaga
gaagacttcgagatttacatcaagggaggacgcgtgcctccacctattcggacttgggca
gagagcgcactgccgtgggagttgattgaggctgtgaagcatgcaaactacgaccgacct
acaccgattcaaatgcaggcgatccccatcgctctcgagcagcgagacctgattggcatt
gcagaaactggatccggaaagacagcggcgttcgtgctacccatgctgacgtatgtgaag
ggcctgccgccgctgaatgaagacactgggcaagatggaccctacgcactcattttggcg
ccttccagagaactggcccttcagattgacgaagagacgcagaagttcgcctccttctgc
aagtgccagaccgttgctgtcgtcggaggccgcagcgccgaaacacaggccttccaacta
cgcagaggtgctgagattgtcatcggaacccctgggcgtgtcaaggactgcctcgagaag
gcgtacaccgttcttaatcaatgcaactatgttgtccttgacgaagcagatcgaatgatt
gatatgggttttgaggagatcgtgaatttcattttagatcaaattccgacttccaatttg
aagagcaacgacgaagccctcatccttcaacaagagatgcaagcgaaggcaggccaccgg
ctgtaccgcctcacgcaaatgttcagcgcgacgatgcctccggctgtggagcgactggca
cgcaagtatctgaggcagccttcgtatatctccattggcgatcccggtgctggcaagcga
gcaatcgagcagcgcgtggagtttgtccctgaggcgcgtaagaagcaacgccttcaggac
gtgctcgaaaacgctacacctccagtcatggttttcgtcaatcagaagaaatctgcagac
gcactggccaaggtcctcggcaagttgggatacagtgcatgctcgcttcacggaggaaag
gcgcaagaaaatcgcgaggctgctctttcgtctttcaaggaaggaagtcacgatgttctc
gtagcgacagacgttgctgggcgaggtattgacgttgagggggtgcaacttgtggtaaac
ttcgatatgcctaaagatatcgaagcgtacacccatcgaatcggtcgtacgggtcgtgcg
ggacggaagggtctcgcgatctcgttccttaccgaagaggatagtgggattttctatgac
ctcaagcagctgcttgtttcgacaaacaacattgtgcctcttgagcttgcccatcatccg
gcagccaaggcgaaaggtggcgacaaaaatttgatcaagccgatttggttcaattga

DBGET integrated database retrieval system