KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0699Help
Entry
Tgr7_0699         CDS       T00840                                 

Definition
(GenBank) serine/threonine protein kinase with CHASE2 sensor
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tgr01001]
    Tgr7_0699
Enzymes [BR:tgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Tgr7_0699
Protein kinases [BR:tgr01001]
 Serine/threonine kinases: Other
  Bacterial family
   Tgr7_0699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr CHASE2 TPR_2 Pkinase_fungal TPR_12
Motif
Other DBs
NCBI-ProteinID: ACL71791
UniProt: B8GMF9
LinkDB All DBs
Position
complement(753115..755715)
Genome map
AA seq 866 aa AA seqDB search
MPVTGSDKTMVAPPPDNTRDTVALSGLSAQQRQRRPLRLRGRDLHRLLVAAFLIIILALS
YAQWPRSLDHLAYDLATRMVPGEADLSSVAFVDMGPAQSTADHDTLNRALAALQSQGVQA
IGVYLPLNQPQSPSDLQRLMQAAEQGERGAPDPRWLVQLDRDGRLATTLRRHGNVVLAAP
PATLPAATPGSTLSPVAEGFSGWQAHPWLAPLMYAPGTNFSALPLAEPIAPLASAARAVG
AALPVTPGRGVPLAVAHEDGYRSGFLLPLLAQGGMPELEPGRGLRLGAQLIPLGPGLAAH
PLPPSRDLRRGGVETVSLDMVLGRGASVTERLAGRTVILGPGAARGHTGQPADTVPEALW
QTYVLGSLLDGAWVRVPAWTHGLERLLLLLVCLYLLVMPARLMGRSSGLLIGLLLGVVVF
NAGLLLLLVQQLWLPVTLPIVALLLGHGLIWGGLRYADANERDRLDASRAHRKLGAMLRA
QGDLESAFEHLVQARVVDDGLREELYQLGHDLVRRRQYARAREVYGHLEWLSPHYRDVPV
RIERLKGLAGQGRARLGTEHSTADSNLIVDGDTLEKPTLGRYQVECQLGRGSMGVVYLGV
DPKIGRKVAIKTLALNQEFESEMLEQVKWRFFREAEASGRLNHRNIVTIYDVGEEHDLAF
IAMDYLEGSSLESYVHRDALLPVAEVLEICAQVAEGLAYAHDQHVIHRDVKPANVIYDRS
RHSVKITDFGIACLTDNNRTRTGTILGTPAFMSPEQVSGQPVDGRSDLFALGVTLYQLLT
GQLPFTADTMAGLVYQITQTRHQSISELRPELGPLVALIVNRALEKDPARRYQSGTELAK
GLRDCAVAMKRGPKPGQFTGHQAATP
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgaccggctccgacaaaaccatggtggcgccccctcccgacaacacacgggat
acggtcgccctgtccggactgtccgcacaacaacgtcaacgccggccgctgcgcctgcgc
gggcgtgacctgcaccgcctgctggtggctgcatttctgatcatcatcctggccctctcc
tacgcccaatggccccgcagcctggatcacctggcctacgacctggccacccgcatggtg
cctggggaagcggacctctcctccgtggccttcgtggacatgggcccggcgcaaagcacc
gcggaccatgacaccctgaaccgcgccctggccgccctgcaatcccagggagtccaggcc
atcggcgtctatctgcccctgaaccagccccagtccccatcggatctgcagcgcctcatg
caggccgcagaacagggcgaacgcggcgcgccggacccccgctggctggtccagctggac
cgggacgggcgtctggccaccaccctgcgccgccatggcaacgtggtgctggcagcgccg
ccagccacgctgcccgccgccacccctggctccacactcagccccgtggccgagggcttc
agcggatggcaggcccacccctggctcgcccccctgatgtatgcaccggggacaaatttc
agcgccctgcccctggccgaacccattgcccccctggccagcgccgcccgggccgtgggg
gccgccctgcccgtgacccccggtcgaggcgtgcccctggcggtggcccatgaggacggt
taccggtccgggttcctgctgcccctcctggcccagggggggatgccagaactggagccc
ggtcgaggcctgcgcctgggcgctcaactgatccccctgggaccggggcttgccgcccac
cccctgccgccgagccgggatctgcgtcgcggcggcgtggagaccgtcagcctggacatg
gtgctgggccggggcgcctccgtcaccgagcgcctggcaggacgcaccgtgatcctcggt
cccggcgcagccaggggccataccgggcaacccgccgacaccgtgcccgaggccctgtgg
cagacctatgtcctgggcagcctcctggacggggcctgggtgcgggtacctgcctggacc
catggcctggaacggctgctgttgctgctggtctgtctgtacctgctggtcatgccggcc
cggctcatgggccgatccagcgggctgctcataggcctgttgctgggcgtggtggtcttc
aacgccggcctgctcctgctgctggtacagcaactgtggctgccggtgaccctgccgatc
gtggccctgctgctgggccatggcctgatctggggcggcctgcgctatgccgacgccaac
gagcgggaccgtctggatgcctccagggcccatcgcaagctcggtgccatgctgcgcgcc
cagggcgatctcgagtcggcctttgagcacctggtccaggcccgggtggtggatgacggg
ctgcgcgaggagctctaccagctgggccatgacctggtgcgccgccgccagtacgcccgg
gcccgggaggtctacgggcacctggagtggctgtcaccccactaccgtgacgtgccggtg
cgcatcgagcgactcaagggtctggcgggccagggccgtgcccgactgggcaccgagcat
tccaccgcggacagcaatctgatcgtcgacggcgacaccctggaaaaacccaccctgggc
cgataccaggtcgagtgccagctggggcggggctccatgggggtggtctacctgggcgtg
gatcccaagatcgggcgcaaggtggccatcaagaccctggccctgaaccaggagttcgag
tccgagatgctcgagcaggtcaaatggcgcttcttccgggaagcggaggcctccgggcgc
ctcaatcatcgcaacatcgtgaccatctacgacgtgggcgaggaacatgaccttgccttc
atcgccatggactaccttgagggcagctccctggaatcctacgtgcaccgggatgccctg
ctgcccgtggccgaggtactggagatctgcgcccaggtggccgagggcctggcctacgcc
cacgaccagcatgtgatccaccgggacgtgaagccggccaacgtgatctatgaccgaagc
cgccactcggtgaagatcaccgacttcggcatcgcctgtctcaccgacaacaaccgcacc
cgcaccggcaccattctgggcacaccggccttcatgtccccggagcaggtctccgggcag
ccggtggacggacgctccgacctgttcgccctgggcgtgaccctgtatcaactgctgacc
gggcagctgcccttcaccgccgacaccatggccgggctggtctaccagatcacccagacc
cggcaccagtccatctccgaactgcgcccggagttgggtcccctggtggccctgatcgtc
aaccgcgccctggagaaggatcccgcgcgtcgctaccagagcggcaccgaactggccaag
ggcctgcgcgactgtgccgtggccatgaagcggggccccaaacccggccagttcaccggc
caccaggccgccaccccctga

DBGET integrated database retrieval system