KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0772Help
Entry
Tgr7_0772         CDS       T00840                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00473  D-Alanine metabolism
tgr00550  Peptidoglycan biosynthesis
tgr01100  Metabolic pathways
tgr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tgr7_0772
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tgr7_0772
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Tgr7_0772
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tgr01011]
    Tgr7_0772
Enzymes [BR:tgr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Tgr7_0772
Peptidoglycan biosynthesis and degradation proteins [BR:tgr01011]
 Precursor biosynthesis
  Amino acid ligase
   Tgr7_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 TTL ATPgrasp_YheCD ATP-grasp ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACL71864
UniProt: B8GMN2
LinkDB All DBs
Position
829873..830802
Genome map
AA seq 309 aa AA seqDB search
MNPRSFGKVAVLLGGWSAEREISLISGGEVLKALQAAGVDAHGIDAGRDVLEVLKAGGFD
RVFNMLHGRGGEDGVIQGALELIGLPCTGSGVLGSAVSMDKLMTKRLWRGAGLPTPDYQV
LDGDTDWVVVASGLGLPLIVKPALEGSSIGMSKVETVGDLPEAYARAAACGGPVFAERWV
TGTEYTAAILEGEPLPLIRLETPRAFYDYEAKYKAETTRYHVPCGLEAAVEQRFQSLALQ
AFEAVGARGWGRVDLMVDRVGVPWLIEVNTVPGMTDHSLVPMAARAAGLDFQALVLRILA
GTLASGERQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccaggtccttcggcaaggtggcggtgctcctgggcggctggtccgcggaacgg
gagatctcgctcatcagcggcggcgaggtgctcaaggccctgcaggccgccggcgtggac
gcccacggcatcgatgccggccgggacgtgctggaggtgctcaaggccggcggtttcgac
cgggtgttcaacatgctccacgggcggggcggcgaggacggcgtgatccagggcgccctg
gagctgatcggcctgccctgcaccggcagcggcgtgctgggctcggcggtgagcatggac
aagctcatgaccaagcgcctgtggcgcggcgcgggcctgcccacccccgattaccaggtg
ctggacggggacacggactgggtggtggtggcctcgggcctgggcctgccgctgatcgtc
aagccggccctggagggctcgagcatcggcatgagcaaggtggagaccgtgggtgatctg
cccgaggcctatgcccgtgccgccgcttgcggcgggccggtgttcgccgagcgctgggtg
accggcaccgagtacacggcggcgatcctcgagggcgagcccctgccgctgatccgcctg
gagacgccccgggccttctacgactacgaggccaagtacaaggccgagaccacccgctac
cacgtgccctgcgggctggaggcggcggtggaacagcgcttccagtccctggccctgcag
gccttcgaggcggtgggcgcccggggctggggccgggtggacctgatggtggaccgggtg
ggtgtgccctggctgatcgaggtgaacaccgtgcccggcatgaccgaccacagcctggtg
cccatggcggcccgggccgcgggcctggatttccaggccctggtgctgcgcatcctggcc
ggcaccctggcttccggggagcggcaatga

DBGET integrated database retrieval system