KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1407Help
Entry
Tgr7_1407         CDS       T00840                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tgr7_1407
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tgr01003]
    Tgr7_1407
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tgr01011]
    Tgr7_1407
Enzymes [BR:tgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Tgr7_1407
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Tgr7_1407
Glycosyltransferases [BR:tgr01003]
 Polysaccharide
  Bacterial polysaccharide
   Tgr7_1407
Peptidoglycan biosynthesis and degradation proteins [BR:tgr01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Tgr7_1407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase Beta-lactamase2 UvrB_inter
Motif
Other DBs
NCBI-ProteinID: ACL72492
UniProt: B8GRD8
LinkDB All DBs
Position
1505825..1508071
Genome map
AA seq 748 aa AA seqDB search
MLVGLLGLGGYTAYLDYEIRSQFEGKRWSLPARVFARPLEIYPGRELDRAQLTRELELLH
YRRGDAIRSGEFREQGGRLILSTRGFPFADGVEPPRRLSVDLRDGRVAAVTELETGRPAA
LVRLEPALIANIYPRHGEDRVLVRLDEVPPLLVSALIAVEDRKFYEHHGLDFSAIARAAW
ANLRAGRTVQGGSTLTQQLVKNYFLTQDRTLRRKFNEAIMALLLEWRYEKDEILEAYLNE
VYLGQDGDRAIHGFGLASQFYFQRRLDELHPEQIALLVALVRGPSFYDPRRRAERAQARR
DLVLDILEAQGGLERDVLARAKARPLGVGARPPSGITPFPAFLDLVREQLRRDYREQDLQ
TEGLLIFTTLDPSIQLATEAAVARRLAQIERARGIEAGSLQAGAVVSAVDNGEVLAVVGD
RNPRNAGFNRALNARRPVGSLVKPAVYLAALSRPRQYTLATLLDDGPLTLTLDDGTEWSP
RNYDREYHGMVTALDALVHSYNIATARLGLEVGLNAVIQQMQRLGVSRNLRPYPSLLLGA
VELTPLEMTHMYQSLAAGGFETPPRAIREVMDANGQLLNRYALDLRQAADPAAVYLVTAA
LHEVTRRGTGASLRGLLPEDLPVAGKTGTTDDNRDAWFAGYAGDFLSVVWVGRDDNAPMG
LTGSSGALPVWADLMKDISRRGLEPIRPDGVEWLLIDPANGLRAVEGCEGAQWMPFIEGS
APAGMSPCAEGVPAAVRRSFRWFRGLFE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgggcctgctgggcctgggcggctacaccgcctacctcgactacgagatccgc
agccagttcgagggcaagcgctggtccctgccggcgcgggtgttcgcccggcccctggag
atctacccgggacgggagctggatcgcgcgcagctcacccgggaactggagctgctgcac
taccgccgcggcgatgccatccgcagcggcgaattccgggagcagggcgggcgcctgatc
ctcagcacccggggcttcccctttgccgacggcgtcgagccgccccggcgcctgagcgtg
gacctgcgtgacggccgggtggccgccgtgacggaactggagaccggccgccccgccgcc
ctggtgcgcctggagccggccctgatcgccaacatctacccgcgccacggcgaggaccgg
gtcctggtgcgtctggacgaggtgccgcccctgctggtcagcgcgctgatcgccgtggag
gaccgcaagttctacgagcaccacggcctggacttctccgccatcgcccgcgccgcctgg
gccaacctgcgcgccggacgcacggtgcagggtggcagcacgcttacccagcagctggtg
aagaactacttcctcacccaggatcggaccctgcggcgcaagttcaacgaggccatcatg
gccctgctgctggaatggcgctacgagaaggacgagatcctggaggcctatctcaacgag
gtctacctgggtcaggacggcgaccgggccatccacggcttcggtctggccagccagttc
tacttccagcggcgcctggacgagctgcatcccgaacagatcgccctgctggtggccctg
gtgcgcgggccttccttctacgatcccaggcgccgcgccgagcgcgcccaggcccggcgc
gacctggtgctggacatcctcgaggcccagggcgggctggagcgggacgtgctcgcccgc
gccaaggcgcgccccctgggcgtgggcgcccggccgccctcgggcatcaccccgtttccc
gccttcctggacctggtgcgcgaacagctgcgtcgggactaccgggagcaggacctgcag
accgagggcctgctcatcttcaccaccctggacccgagcatccagctggccaccgaggcc
gccgtggcccggcgcctcgcccagatcgagcgcgcccggggcatcgaggcaggcagcctg
caggcgggcgccgtggtcagcgccgtggacaacggcgaggtgctcgcggtggtgggcgac
cgcaacccgcgcaacgccggcttcaaccgggcgctgaacgcccgccgcccggtgggctcc
ctggtcaaaccggcggtctacctggccgccctgtcgcgcccccgccagtacaccctggcc
accctgctggacgacggcccgctgaccctgaccctggacgacggcaccgagtggagcccg
cgtaactacgaccgggagtaccacggcatggtgacggccctggacgccctggtgcactcc
tacaacatcgccaccgcgcgcctgggcctggaggtggggctcaatgccgtgatccagcag
atgcagcgcctgggcgtgagccgcaacctgcgcccctatccctccctgctgctgggggcc
gtggagctcacgcccctggagatgacccacatgtaccagtccctggccgcgggcggtttc
gagaccccgccccgggccatccgcgaggtcatggacgccaacggccagctgctcaaccgc
tatgccctggacctgcgccaggcggccgacccggccgccgtgtacctggtgaccgccgcc
ctgcacgaggtcacccggcgcggcaccggcgcgagcctgcgcggcctgctgcccgaggac
ctgccggtggcgggcaagaccggcaccaccgacgacaaccgcgacgcctggttcgccggc
tacgccggggacttcctgtccgtggtctgggtgggccgcgacgacaacgccccgatgggc
ctgaccggctcatcgggtgcgctgcccgtgtgggcggatctgatgaaggacatcagccgc
cgcggcttggagcccatccggcccgatggcgtagaatggctgctgatcgaccccgccaac
ggcctgcgtgccgtggaaggctgcgagggcgcccagtggatgccgttcatcgaaggttcg
gcacccgcgggcatgtctccctgcgccgagggggtccccgccgcggtgcggcgatccttc
cgctggttcagagggctgttcgagtaa

DBGET integrated database retrieval system