KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1467Help
Entry
Tgr7_1467         CDS       T00840                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00020  Citrate cycle (TCA cycle)
tgr00190  Oxidative phosphorylation
tgr00650  Butanoate metabolism
tgr01100  Metabolic pathways
tgr01110  Biosynthesis of secondary metabolites
tgr01120  Microbial metabolism in diverse environments
tgr01130  Biosynthesis of antibiotics
tgr01200  Carbon metabolism
Module
tgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tgr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tgr7_1467
   00650 Butanoate metabolism
    Tgr7_1467
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Tgr7_1467
Enzymes [BR:tgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Tgr7_1467
    1.3.5.4  fumarate reductase (quinol)
     Tgr7_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like NAD_binding_7 FAD_binding_3 TMP-TENI Lycopene_cycl Thi4 GIDA Pyr_redox_3 TPD52
Motif
Other DBs
NCBI-ProteinID: ACL72551
UniProt: B8GRJ7
LinkDB All DBs
Position
1569909..1571672
Genome map
AA seq 587 aa AA seqDB search
MGVTVRKFDALIIGAGGAGLRAALQLANAEASVAVVSKVFPTRSHTVAAQGGVNAALANV
LPDSWHWHMYDTVKGSDWLGDQDAIEYMCRAAPKVVYELEHFGVPFSRLDNGNIYQRAFG
GQSQHFGKEQAARTCAAADRTGHAILHSLYQQNIRAKTHFFDEYFAVDLLKDEEGYVLGA
LAFEILTGEPIVIEAKTTLLATGGVGQLFRTCTNALINTGDGMSMALRAGIPLQDMEFFQ
FHPTGIAGRGMLITEGARGEGGYLLNADGERFMERYAPNAKDLASRDVVSRAIYTEVKEG
RGCGPEKDYVLLQLTHLGRDKIMQRLPGIRETCITFLGLDPIDHPIPIYPTAHYTMGGIP
TNRFGQVVVPVKDTPEDPVPGLYAAGEAACVSVHGANRLGGNSLLDILVFGRAAANHIID
VLEHNRYHRPLHQPAVDAALERFHRWDRKGDGEHVDQLRQELRKVMEAHCGVFRTEEVMA
EGVAKVKAIAERVKDAVLRDHSKVFNTARVEAMELENLVDCALATVQSALGRKESRGAHS
RIDYPDRDDTHWLKHTLYFKHSDSLDYKPVRTKPMTVESFPPKVRVY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtaacggttcgcaagttcgacgcactcatcatcggcgccggcggcgccggcctg
cgcgcggccctgcagctggccaacgccgaggccagcgtggcggtggtctccaaggtcttt
cccacccgctcccacaccgtggcggcccaggggggcgtgaatgccgccctggccaacgtg
ctgccggacagctggcactggcacatgtacgacacggtcaagggcagcgactggctgggc
gaccaggacgccatcgagtacatgtgccgggcggcacccaaggtggtctacgagctggag
cacttcggcgtgccgttctcgcgcctggacaacggcaacatctaccagcgggccttcggc
ggccagagccagcacttcggaaaggagcaggcggcacgcacctgcgcggctgcggaccgc
accggccacgccatcctgcacagcctctaccagcagaatatccgcgccaagacccatttt
ttcgacgaatactttgccgtggacctgctcaaggacgaggagggctatgtgctcggcgcg
ctggccttcgagatcctcaccggcgagcccatcgtcatcgaggccaagaccacgctgctg
gccaccggcggcgtgggccagctgttccgcacctgcaccaacgccctgatcaacaccggc
gatggcatgagcatggccctgcgcgcgggcatcccgctgcaggacatggagttcttccag
ttccaccccacgggcatcgccgggcgcggcatgctgatcaccgagggcgcccggggtgag
ggcggctatctgctcaacgccgatggcgagcgcttcatggagcgctacgcgcccaacgcc
aaggacctggccagccgcgacgtggtgagccgcgcgatctacacggaggtgaaggagggc
aggggttgcggaccggagaaggactatgtgctgctgcagctgacccacctgggccgggac
aagatcatgcagcgactgccgggcatccgggaaacctgcatcaccttcctgggactcgat
cccatcgatcaccccatccccatctacccgaccgcccactacaccatgggtggcatcccc
accaaccgtttcgggcaggtggtggtgccggtcaaggacacgccggaggatccggtgccg
gggctgtatgcggcgggtgaggcggcctgtgtctcggtccacggcgcaaaccgcctgggc
gggaattccctgctggacatcctggtgttcggccgcgccgcggccaatcacatcatcgac
gtgctcgagcacaaccgttatcaccgtcccctgcatcaacccgccgtggatgcggccctg
gagcgcttccaccgctgggaccgcaagggcgacggcgagcacgtggaccagctgcgacag
gaactgcgcaaggtcatggaggcccactgcggtgtgttccggaccgaagaggtcatggcc
gagggcgtggccaaggtcaaggccatcgccgagcgggtcaaggacgcggtgctgcgggat
cacagcaaggtcttcaacaccgcccgtgtggaggccatggagctggaaaacctggtggac
tgcgcgctggccacggtgcaatcggccctcgggcgcaaggaaagccgcggcgcccactcg
cgcatcgactatcccgatcgcgacgacacccactggctcaagcacaccctgtacttcaag
cacagcgacagcctggattacaaaccggtgcgcaccaagcccatgaccgtcgagagcttc
ccgcccaaggttcgggtgtactga

DBGET integrated database retrieval system