KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1481Help
Entry
Tgr7_1481         CDS       T00840                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00020  Citrate cycle (TCA cycle)
tgr00190  Oxidative phosphorylation
tgr00650  Butanoate metabolism
tgr01100  Metabolic pathways
tgr01110  Biosynthesis of secondary metabolites
tgr01120  Microbial metabolism in diverse environments
tgr01130  Biosynthesis of antibiotics
tgr01200  Carbon metabolism
Module
tgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tgr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tgr7_1481
   00650 Butanoate metabolism
    Tgr7_1481
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Tgr7_1481
Enzymes [BR:tgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Tgr7_1481
    1.3.5.4  fumarate reductase (quinol)
     Tgr7_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4_4
Motif
Other DBs
NCBI-ProteinID: ACL72565
UniProt: B8GRL1
LinkDB All DBs
Position
1586383..1587084
Genome map
AA seq 233 aa AA seqDB search
MRFSIYRFNPETDAEPYMQDFELPDAQVEPGMMLLEALLRLKRQDETLSFRRSCGEGVCG
SDGMNINGTNGLACVTPLASLKQPITLRPFPGMPVIRDLIVDMGNFYNQYRKAKPYLVIN
DPVPEVERKQSPQDREKLDGLYECILCGCCSASCPSYWWNPDKFLGPAALLQSARFILDS
RDQATPERLEQLDDAYKLYRCHTIMNCVQVCPKGLNPTKAIGEIKKQMLKRSL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttctccatctaccgcttcaacccggaaaccgacgccgaaccctacatgcaggat
ttcgaactcccggacgcccaggtggaaccgggcatgatgctgctggaggcgctgcttcgg
ctcaaacgccaggacgagaccctgagtttccggcgctcctgtggggagggcgtgtgcggc
tccgatggcatgaacatcaacggcaccaacggactggcctgcgtcacacccctggcaagc
ctcaagcaacccatcaccctgcgacccttcccgggcatgccggtgatccgcgacctgatc
gtggacatgggcaacttctacaaccagtaccgcaaggccaagccctacctggtgatcaac
gatccggtgccggaggtggagcgcaagcagtcgccgcaggatcgcgagaagctggacggc
ctgtatgaatgcatcctgtgcggctgctgttccgcctcctgtccctcatactggtggaac
ccggacaagttcctgggtccggccgcgctgctgcagtcggcccggttcatcctggactcc
cgggaccaggccacccccgaacgactggaacagctggacgatgcctacaagctctaccgc
tgtcacaccatcatgaactgcgtacaggtctgcccgaagggcctcaatcccaccaaggcc
atcggcgagatcaagaagcagatgctcaagcgctccctgtga

DBGET integrated database retrieval system