KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1575Help
Entry
Tgr7_1575         CDS       T00840                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tgr7_1575
Enzymes [BR:tgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Tgr7_1575
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Tgr7_1575
Peptidases and inhibitors [BR:tgr01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Tgr7_1575
Peptidoglycan biosynthesis and degradation proteins [BR:tgr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Tgr7_1575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ACL72659
UniProt: B8GRV5
LinkDB All DBs
Position
1690460..1691842
Genome map
AA seq 460 aa AA seqDB search
MLRQILPLILLLLAGLNTASAQNLLPAQVNRVIQAHGMDPARVAIWVQPVNADKPWLAHN
PDTALNPASVIKLATSLAALEVLGPAYTWKTRVHLGGPVEQGVLKGDLWLIGGGDPFLVT
EEFWKLLGALRRQGIRRIEGDLVFDLSYFRLPDEEPAAFDGQPHRVYNQGPHPLLVNFNA
LHVEVMPDPDGDAVSAVVDPPIAGLHIDNRLRQRAGPCGGYRLGISYRVLEERTGIGLDG
RFPGSCGPHRFARTALTPEAYVHGLFRSLWAQWGGEFEGGWRVDTWSDVEREPTLVHESR
PLGELIRLANKHSNNVMTRHFELTLGAETFGMPATPEKGLNAILDYLAARGIDSKGLVLD
NAAGLSRHNRVTARQLAGILRAGRQSPLHAGIHLLSGPGRSGRHPAQPLRGRSCRRAHAP
QNRFPGRGVQHRRLREDRHRRGRDGGGDGQRPGRAVEHGH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgctccgccagatcctgcccctcatcctgctactgctcgccggtctgaacactgccagc
gcccagaacctgctgccggcacaggtcaaccgcgtcatccaggcccatggcatggacccg
gccagagtcgccatctgggtacagcccgtgaatgccgataagccctggctggcccacaac
ccggacaccgccctcaaccccgcctcggtgatcaagctggccaccagcctggcggccctg
gaggtgctcggtccggcctacacctggaagacccgggtgcacctggggggaccggtggag
cagggggtgctcaagggggacctgtggctcatcggcggcggcgaccccttcctggtcacc
gaggaattctggaagctgctcggggcgctgcgccgccagggcatccggcgcatcgagggg
gacctggtcttcgacctgtcctacttccgcttgcccgatgaggagccggccgccttcgac
ggacagccccaccgggtctacaaccaggggccgcacccgctgctggtgaacttcaacgcc
ctgcacgtggaggtgatgccggatccggacggcgacgcggtgagcgccgtggtggacccg
cccatcgcgggactgcacatcgacaaccgcctgcgccagcgtgccggaccctgcggcggg
tatcgcctggggatcagctaccgggtgctggaggagcggaccggcatcggcctggacgga
cgcttcccgggcagttgcggaccccaccgattcgcccgcacggcactcacgcccgaggcc
tacgtacacgggttgttcaggagtctctgggcccagtggggcggggagttcgagggcggc
tggcgggtggatacctggagcgatgtcgaacgcgaacccaccctggtgcatgaatcccgg
cccctgggcgaactcatccggctggccaacaagcacagcaacaacgtcatgacccggcac
ttcgagctgaccctgggcgccgagaccttcggcatgccggccaccccggagaagggcctg
aacgccatcctggactacctggccgcccggggcatcgacagcaagggcctggtcctggac
aacgccgccggcctgtcgcgtcacaaccgcgtcaccgcccggcaactggcaggcatcctg
cgtgccgggcggcagagcccccttcatgccggaattcatctcctctctggccctggccgg
tctggacggcaccctgcgcagccgcttcgaggacgatcctgccgcagggcgcatgcacct
caaaaccggtttcctggaaggggtgtccagcatcgccggctacgtgaagaccgccaccgg
cgaggacgtgatggtggtggtgatggccaacggcccgggcgtgcagtggagcacgggcat
tga

DBGET integrated database retrieval system