KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2707Help
Entry
Tgr7_2707         CDS       T00840                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00550  Peptidoglycan biosynthesis
tgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tgr7_2707
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tgr01002]
    Tgr7_2707
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tgr01011]
    Tgr7_2707
Enzymes [BR:tgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Tgr7_2707
Peptidases and inhibitors [BR:tgr01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Tgr7_2707
Peptidoglycan biosynthesis and degradation proteins [BR:tgr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Tgr7_2707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ACL73782
UniProt: B8GMW7
LinkDB All DBs
Position
complement(2848193..2849368)
Genome map
AA seq 391 aa AA seqDB search
MIQRILLSLICLLLIAPLGQALAQSTVRVPPPSDLESRNYLIMDHLSGMVLAERAADERV
EPASLTKLMTAYLVFQEIERGTISLDDEVRISERAWRTGMQGASRMFIEVNNRVRLQDLL
RGLIIQSGNDASVALAEHVGGTEGAFVDLMNAQARALGMVNTHFTNSHGLPTEEAQYTSA
RDMALLASALIRDFPQHYGYYSERNFTFNGITQSNRNLLLWRDSQVDGLKTGWTRTSGYN
LVSSREQEGMRLVAVVMGIDAPSHQQGGIKRANESQALYSWGFRQFETHRLYEAGAALTD
ARVWKGATDRVPMGLSEDLYVTVPRGRYRDMQAQMELDASLEAPVQAGEVYGEVQLILDG
EILSRRPLVALESVETGGIFRRLLDSVLQMF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgattcagcgcattctcctcagcctcatctgcctcctcctgatcgcgcccctgggccag
gccctggcccagtccaccgtacgcgtgccgccgccctcggacctggagtcgcgcaactac
ctgatcatggatcacctgagcggcatggtgctggccgagcgcgccgccgacgagcgggtc
gaacccgccagcctgaccaagctcatgaccgcctacctggtgttccaggagatcgaacgc
ggcaccatctccctggacgacgaggtgcgcatcagcgagcgcgcctggcgcaccggcatg
cagggcgcctcgcgcatgttcatcgaggtcaacaaccgggtgcggctgcaggacctgttg
cgcggcctgatcatccagtcgggcaacgacgccagcgtcgccctggccgagcacgtgggc
ggcaccgagggggccttcgtggacctgatgaacgcccaggcccgggccctgggcatggtc
aatacccatttcaccaattcccacggcctgcccaccgaagaggcccagtacacctccgcc
cgggacatggccctgctggccagcgccctgatccgggatttcccccagcactacggctac
tactccgagcgcaacttcaccttcaacggcatcacccagtccaaccgcaacctgctgctg
tggcgggacagccaggtggacggcctgaagaccggctggacccgtacctcgggctacaac
ctggtgtcctcccgcgagcaggagggcatgcgcctggtggcggtggtgatgggcatcgat
gcccccagccatcagcagggcggcatcaagcgcgccaacgagtcccaggccctgtacagc
tggggcttccgccagttcgagacccaccgcctctacgaggccggcgccgcgctgaccgac
gcgcgggtgtggaagggcgccaccgaccgggtgcccatgggcctgagcgaggacctgtac
gtcaccgtgccccgtggccgctaccgcgacatgcaggcgcagatggagctggacgcgagc
ctcgaggccccggtgcaggccggcgaggtctacggcgaggtgcagctcatcctggacggc
gagatcctgagccgccgccccctggtggccctggaatccgtcgagaccggcggcatcttc
cgccgcctgctggattccgtgctgcagatgttctaa

DBGET integrated database retrieval system