KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2711Help
Entry
Tgr7_2711         CDS       T00840                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00550  Peptidoglycan biosynthesis
tgr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tgr7_2711
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Tgr7_2711
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tgr01011]
    Tgr7_2711
Enzymes [BR:tgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Tgr7_2711
Peptidoglycan biosynthesis and degradation proteins [BR:tgr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Tgr7_2711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ACL73786
UniProt: B8GMX1
LinkDB All DBs
Position
complement(2852509..2854365)
Genome map
AA seq 618 aa AA seqDB search
MAVRQAIKNHQQEQRLFFSRAVIMVLVVLILVGTLATRLTFLQVVNYSHFTTLSQNNRVR
LEAVPPPRGLIYDRNGVVLAENRPSYQLEITPEQVRDLEDTLARLTDLLSLEEAEITRFR
RELRGKRPFQAVPVKLNMSDEEVAIFAINRHLFPGVDIQARLARHYPLGEEMAHVVGYVG
RIDERELARIDRRNYSGTTHIGKIGVERFYEDVLHGRVGYQKVEVNAQGRVLRVLEREAP
VPGRDLVLSLDVGLQAAARRALEGRNGAVVAMDPNTGEVLALVSKPSFDPNLFVHGIPAS
VFNELRNDRYQPLFNRALSGQYPPGSTIKPIVGLAGLEAGVTTAARTMFARGYFQLPNDD
RRYRDWRREGHGLVNLDKAIAQSSDVYFYDLGVRMGIDRMSPFLGQFGLGQVTGLDTTGE
RPGLLPSREWKRATQNMPWFPGETVITSIGQGYMLATPLQMASMTSTIATRGERVRPHLL
RGIIDPVSGDLRLHETEWLTPVQVSRPEHWDQVIQPMINSVHRSNGTAYWSTGRFIRGYT
LAGKTGTAQVFGLAEDEEYDEEGLAKHLRDHALFIGYAPAEAPRIAVAVISEHGGSGGRV
AAPIAREVIDYYLLREER
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccgacaggcgatcaagaaccaccagcaggaacagcgcctgttcttttcccgt
gccgtgatcatggtgctggtggtgctgatcctggtcggcaccctggccacacggctcacc
ttcctgcaggtggtcaactattcccacttcaccacgctttcccagaacaaccgcgtgcgg
ctggaggcggtgcccccgccccgcggcctgatctacgaccgcaacggcgtggtgctggct
gagaaccgtccctcctaccagctggagatcaccccggaacaggtccgtgacctggaggac
accctggcccgcctcacggacctgctgtccctggaagaggcggaaatcacccgcttccgc
cgcgagctgcgcggcaagcgccccttccaggcggtgccggtgaagctcaacatgagcgac
gaggaggtggcgatcttcgccatcaaccggcacctgttccccggcgtggacatccaggcg
cgcctggcccggcactatcccctgggcgaggagatggcccacgtggtgggttacgtgggg
cgcatcgacgagcgcgaactggcgcgcatcgaccggcgcaactacagcggcaccacccac
atcggcaagatcggcgtggagcgcttctacgaggacgtgctgcacggccgggtgggttat
cagaaggtggaggtcaacgcccagggccgggtgctgcgggtgctggagcgcgaggccccg
gtgccggggcgggacctggtgctgagcctggacgtgggcctgcaggccgccgcgcgccgg
gccctggaggggcgcaacggagccgtggtggccatggaccccaacaccggcgaggtgctg
gccctggtgagcaagccgagcttcgaccccaacctgttcgtgcacggcatccccgccagc
gtgttcaacgaactgcgcaacgaccgctaccagcccctgttcaaccgcgccctctcgggc
cagtacccgcccggctccaccatcaagcccatcgtcggtctggcgggcctggaggctggc
gtgaccacggcggcacgcaccatgttcgcccggggctacttccagttgcccaatgacgat
cgccgctaccgcgactggcgccgggagggacacgggctggtgaacctggacaaggccatc
gcccagtcctcggacgtgtacttctatgacctgggggtgcgcatgggcatcgaccgcatg
tcacccttcctgggtcagttcggcctggggcaggtgacggggctggacaccaccggcgag
cgcccgggcctgctgcccagccgggaatggaagcgcgccacccagaacatgccctggttc
ccgggcgagacggtgatcacctccatcggccagggctacatgctggccacgccgctgcag
atggcctccatgaccagcaccatcgccacccggggcgagcgggtgcgtccgcacctgctg
cgcggcatcatcgacccggtgagcggcgacctgcgcctgcatgaaaccgagtggctgacc
ccggtgcaggtctcccgcccggaacactgggaccaggtcatccagcccatgatcaattcc
gtgcaccgcagcaacggcaccgcctactggtccaccgggcgcttcatccgcggctatacc
ctggccggcaagaccggcaccgcacaggtgttcggtctggctgaggacgaagagtacgac
gaggaggggctggccaagcacctgcgcgaccacgccctgttcatcggttacgcgccggcg
gaggcgccgcgcatcgcggtggccgtgatctccgaacacggcggcagcggcgggcgtgtg
gccgcgcccatcgcccgcgaggtgatcgactactacctgttgcgggaggagcgctga

DBGET integrated database retrieval system