KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2775Help
Entry
Tgr7_2775         CDS       T00840                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00030  Pentose phosphate pathway
tgr00710  Carbon fixation in photosynthetic organisms
tgr01100  Metabolic pathways
tgr01110  Biosynthesis of secondary metabolites
tgr01120  Microbial metabolism in diverse environments
tgr01130  Biosynthesis of antibiotics
tgr01200  Carbon metabolism
tgr01230  Biosynthesis of amino acids
Module
tgr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tgr_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tgr7_2775
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tgr7_2775
Enzymes [BR:tgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Tgr7_2775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ACL73849
UniProt: B8GNF8
LinkDB All DBs
Position
2914124..2914780
Genome map
AA seq 218 aa AA seqDB search
MNQDQMKKAAAEAAIEYVESGMIVGVGTGSTANHFIDLLAAIKDRIDGTVASSEASAQRL
RGHGIQVMDLNTAGQLPLYVDGADESNAELHLIKGGGGALTREKIVAAASDKFVCIADES
KLVDVLGAFPLPVEVIPMARAYVARELTKLGGQPVLREGFTTDNGNVILDVHNLQISDPV
AMEDHINQLPGVVTVGIFAQRPADVLILGSAGGIRKIG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggaccagatgaaaaaggccgcggcggaagccgccatcgaatacgtggaatcc
ggcatgatcgtcggcgtgggcaccggctccaccgccaaccacttcatcgatctgctggca
gccatcaaggaccgcatcgacggcaccgtcgcctcctccgaggccagtgcccagcgcctg
cgcggccatggcatccaggtcatggacctgaacaccgccggccagctgcccctgtacgtg
gacggcgccgacgaatccaacgccgagctgcacctgatcaagggtggcggcggcgccctg
acccgggaaaagatcgtggccgccgccagcgacaagttcgtgtgcatcgccgacgagagc
aagctggtggacgtgctgggcgccttccccctgcccgtggaagtgatccccatggcccgc
gcctacgtggcccgggagctgaccaagctgggcggccagccggtgctgcgcgaaggcttc
accaccgacaacggcaacgtgatcctggacgtgcacaacctgcagatcagcgacccggtg
gccatggaagaccatatcaaccagctgcccggcgtggtcaccgtgggcatcttcgcccag
cgcccggcggacgtgctgatcctgggttctgccggcggcatcaggaagatcggctga

DBGET integrated database retrieval system