KEGG   Taeniopygia guttata (zebra finch): 100190046
Entry
100190046         CDS       T01082                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04012  ErbB signaling pathway
tgu04068  FoxO signaling pathway
tgu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100190046 (CDKN1B)
   04068 FoxO signaling pathway
    100190046 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100190046 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100190046
NCBI-ProteinID: NP_001232325
Ensembl: ENSTGUG00000012703
UniProt: B5FXL7
LinkDB
Position
1A
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNREFKKHLQEMEEAYQRKW
NFDFQNHRPLEGRYEWQAVEKGSSPDFYFRPPRLRKAVCKSAGRQSLDVNGNCQTVVFVG
SQGISEDTHCVAQKTDVSENQTDLAEQCTAQRKRPAADDSSPQNKRANTTEEEVSEDSPS
ANSVEQTPKKSSPGRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgcatttctaatgggagtcctaccctggagcgcatggaggccaggcag
tcggagtacccgaagccgtcagcgtgccggaacctcttcgggccggtgaaccacgaagag
ctcaacagggaatttaagaaacacctgcaggagatggaggaggcgtaccagaggaagtgg
aatttcgatttccagaatcacaggccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgacttctacttcagacccccccggctacggaaagccgtctgcaag
tctgctggccgccagagcttggatgtaaacgggaattgccaaaccgtggtttttgtcggt
tctcagggaatctcagaggacactcactgtgtagctcaaaagactgatgtttcagaaaat
cagacggacttagcagagcagtgcactgcccagaggaaaagacccgcagccgatgattcc
tctcctcaaaataaaagagccaatacaacagaagaagaggtttcagaagactctcccagt
gccaattcagtggagcaaacacccaagaaatcaagcccgggaagacatcaaacgtaa

DBGET integrated database retrieval system