KEGG   Taeniopygia guttata (zebra finch): 100190330Help
Entry
100190330         CDS       T01082                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04068  FoxO signaling pathway
tgu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100190330 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100190330 (SOD2)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100190330 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100190330
NCBI-ProteinID: NP_001232398
Ensembl: ENSTGUG00000011381
UniProt: B5G0D0
LinkDB All DBs
Position
3
AA seq 224 aa AA seqDB search
MLRRFAAASRSSAKLVAPLGCLVSRQKHTLPDLPYDYGALEPHINAEIMQLHHSKHHATY
VNNLNVAEEKYKEALAKGDVTTQVSLQPALKFNGGGHINHTIFWTNLSPNGGGEPKGELM
EAIKRDFGSFANFKEKLTAVSVGVQGSGWGWLGYNKEQGRLQIAACANQDPLQGTTGLIP
LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSSRYATCKK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgccgctttgccgccgcgagcagaagcagtgccaagttggtagcacccttgggg
tgcttggtttctaggcaaaagcacactcttcctgacttgccatatgactatggtgctctg
gaacctcatattaatgcagagatcatgcagctgcaccacagcaagcatcatgccacctac
gtgaacaacctgaacgttgctgaggagaagtacaaagaggcgctggcaaaaggtgatgtt
acaactcaggtgtcacttcaacctgcactgaagttcaatggtgggggtcatatcaatcac
accatcttctggacaaacctttctcctaatggaggaggggaacccaaaggagaattgatg
gaagccatcaagcgtgactttggttcctttgcaaacttcaaggagaagctgacagctgta
tcagttggtgttcaaggatcaggctgggggtggcttggctataacaaggaacaggggcgc
ctacagatagcagcttgtgcaaatcaagaccctttgcaaggaacaacaggtctcattcct
ttgctaggcattgacgtatgggaacatgcttattatcttcagtataaaaatgttcgacct
gattatttgaaagccatctggaatgtgatcaactgggagaatgtatcttcaagatatgca
acttgcaaaaagtag

DBGET integrated database retrieval system