KEGG   Taeniopygia guttata (zebra finch): 100190642Help
Entry
100190642         CDS       T01082                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00020  Citrate cycle (TCA cycle)
tgu00190  Oxidative phosphorylation
tgu01100  Metabolic pathways
tgu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100190642 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100190642 (SDHB)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100190642 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 100190642
NCBI-ProteinID: XP_002189250
LinkDB All DBs
Position
21
AA seq 280 aa AA seqDB search
MAAAAVGVSLRSRVPARLLRAGPRAVLRQAQTAAAAPRLKKFAIYRWDPDKAGDKPRMQT
YEVDLNKCGPMVLDALIKIKNEMDFTLTFRRSCREGICGSCAMNIAGGNTLACIKKIDSD
LSKVTKIYPLPHMYVVKDLVPDLSNFYAQYKSIQPYLKKKDESQEGKQQYLQSIEDRQKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAQLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKQKAATA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgcggtcggagtctccttgaggagccgagtccccgcgcggctgctgcgg
gccgggccgcgggcggtgctgcggcaggcgcagacggcggcggcggcgccccggctgaag
aaattcgccatctacagatgggaccccgacaaggccggggacaagccccgcatgcagacc
tacgaggtggacctgaacaagtgtgggcccatggtgctcgatgccctgatcaagatcaag
aacgagatggacttcacgctgaccttccgcaggtcctgcagggaggggatctgcggctcc
tgcgccatgaacatcgctggtggcaacaccctggcctgcatcaaaaaaatcgacagtgac
ctcagcaaagtcaccaaaatctaccccctgccccacatgtacgtggtgaaggacctggtt
ccggacctgagtaacttctacgcccagtacaaatccatccagccctacctgaagaagaag
gacgaatcccaggagggcaagcagcagtacctgcagtccatagaggaccgccagaaactg
gacgggctctacgagtgcatcctgtgtgcctgctgcagcaccagctgtcccagctactgg
tggaacggggacaagtacctgggccccgccgtgctcatgcaggcgtaccgctggatgatc
gactcccgcgatgagttcacggaggagcggctggcgcagctgcaggatcccttctccctg
taccgctgccacaccatcatgaactgcacccgcacctgccccaaggggctgaaccccggc
aaagccatcgccgagatcaagaagatgatggcgacctacaaacagaaagcagcgactgcc
tga

DBGET integrated database retrieval system