KEGG   Taeniopygia guttata (zebra finch): 100217813Help
Entry
100217813         CDS       T01082                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04310  Wnt signaling pathway
tgu04510  Focal adhesion
tgu04520  Adherens junction
tgu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100217813 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100217813 (CTNNB1)
   04520 Adherens junction
    100217813 (CTNNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100217813 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 100217813
NCBI-ProteinID: XP_002199072
Ensembl: ENSTGUG00000004786
LinkDB All DBs
Position
2
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRPDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcaagctgacttgatggagctggacatggcaatggagccagacagaaaagca
gcagtcagtcattggcagcagcaatcatatctggactctggtatccattctggtgccaca
acaactgctccctctttgagtggcaagggaaatcctgaagaagaagatgtggacacaaca
caagtgctgtatgagtgggaacagggattctctcagtccttcacccaggagcaagttgca
gatattgatggccagtatgcaatgactagagctcagagggtgcgtgcagctatgttccct
gaaaccctggatgaaggaatgcagatcccatccacgcagttcgatgcagctcatccaact
aacgtgcagcgcctggcggagccatcccagatgttaaaacacgctgttgttaatttgata
aactaccaagatgatgctgaacttgcaactcgtgcaatcccagaactgaccaaactcttg
aatgatgaggaccaggtggtggtgaacaaggctgcagttatggttcatcagctgtccaaa
aaggaagcgtctcgccacgccattatgagatctcctcagatggtgtctgccattgtacgt
accatgcaaaacacaaacgacgtggagacagcccggtgtactgcagggacactacacaac
ctctcacatcaccgtgaaggcttgttggcaatcttcaaatcaggaggcatccctgctttg
gttaaaatgctggggtccccagtggactctgtgctgttctatgccatcacaactcttcac
aatctcctgttacatcaggaaggagccaagatggctgtccgtctcgctggtgggctgcag
aaaatggtcgccttgctcaacaagacgaacgtcaaattcttggccatcacaacagactgc
cttcagattttagcatatggcaatcaagaaagtaagctgattattctggcaagtggtgga
ccccaggcgttagtaaacataatgaggacctatacttatgagaaactattgtggaccaca
agtagggtgctgaaggtgttgtcagtctgctccagcaacaaacctgctattgttgaggct
ggtgggatgcaagctttggggctccacctcacagatccaagccagcgtcttgtccagaac
tgtctctggactctgagaaatctgtcagatgctgcaacaaagcaggagggcatggaaggc
cttctaggaactctagttcagcttttaggctcagatgacattaatgttgtgacttgtgcc
gctggcatcctttctaaccttacctgcaacaattacaagaacaagatgatggtgtgccag
gtcggtggcatcgaggctctggtgcgcacagtcctccgggctggagacagggaagacatc
acggaacctgcgatttgtgcgctccgtcacctcaccagcagacaccaagaagcagagatg
gctcaaaatgcagttcgtctccattacggacttccagtggtggtaaagctgttgcatcca
ccctcacactggcctttgatcaaggctactgttggcttgatccgcaacctggctctgtgt
cctgcaaaccacgccccgctgcgtgaacaaggtgctattccaaggctagtgcagttgctg
gttagagcacaccaggatacccagcgacgcacttccatgggcgggacacaacagcagttc
gtggagggtgtgcgtatggaagaaattgtcgagggctgcactggagccctgcacattctt
gcacgtgatgttcataatcgaatcgtaatcaggggtctaaataccattccactatttgtg
cagttgttgtactctcccatcgagaatatccagagagtagctgctggtgtactttgtgaa
ctggctcaagacaaggaggcagctgaagcaattgaagccgaaggtgcaactgctccttta
acagaactgcttcattctaggaatgagggtgttgcaacctacgcagctgcagtgctgttc
agaatgtctgaggacaaaccacaggactataagaagcgactttcggttgagttgacaagc
tccctgttccggactgagccaatggcttggaacgagacggcggatctcggactggatatt
ggtgcccagggagagcctcttggataccgcccagatgatcctagctaccgttctttccac
tctggcggatacggtcaggatgccttgggtatggaccctatgatggaacatgaaatgggt
ggccaccaccctggtgctgactacccagttgatggtctgccagatcttggccatgcccag
gaccttatggatgggctgcctccaggtgacagtaatcagttggcctggttcgatactgac
ctgtaa

DBGET integrated database retrieval system