KEGG   Taeniopygia guttata (zebra finch): 100217841Help
Entry
100217841         CDS       T01082                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tgu01002]
    100217841 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tgu04147]
    100217841 (ACE)
   04090 CD molecules [BR:tgu04090]
    100217841 (ACE)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100217841 (ACE)
Peptidases [BR:tgu01002]
 Metallo Peptidases
  Family M2
   100217841 (ACE)
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100217841 (ACE)
CD molecules [BR:tgu04090]
 Proteins
  100217841 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 100217841
NCBI-ProteinID: XP_002191587
Ensembl: ENSTGUG00000001973
LinkDB All DBs
Position
27
AA seq 1277 aa AA seqDB search
MPAALGLLLWLSLAGALRPGLEPPRHEPTEQGAALFASDYNTTAEIVLFDSVSASWNYST
NLTAENAALQVTASLEEQNFTELWGKRAKELYGDKWSNFSDPQLRKIIGSIQTLGPSNLP
LELREKYNTILSDMDKIYSTAKVYLPNGTCWDLEPDLSDIMATSRSYKKLLYAWEGWHNA
AGNPLRPKYEEFVKLSNKAYLEDGFNDTGSYWRSWYDSDSFEKDLEHIYHQLEPLYLNLH
AFVRRKLYDRYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMIPYPEKPSLDVTSTMVQQ
GWNATHMFRVSEEFFTSLGLLEMPTEFWEKSMLEKPTDGREVVCHASAWDFYNRKDFRIK
QCTSVTMEQLFTVHHEMGHIQYYLQYKDQPVSFRSGANPGFHEAIGDVLSLSVSTPSHLK
KIGLLSNATEDEESNINYLLKMALEKIAFLPFGYLIDQWRWNVFSGHTPPSRYNYDWWYL
RTKYQGICAPLSRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTGSLH
TCDIYRSKEAGAKLREVLKAGSSKSWQDILLNLTGTGQMDAEPLLEYFSPVTKWLQEQNN
KTNEVLGWPEFDWRPPVPEGYPEGIDKIADEAQAKEFLSEYNSTAEQVWNAYTEASWAYN
TNITDHNKEIMLEKNLAMSKHTLEYGMRARQFDTSDFQDESVTRILKKLSVIERAALPEN
ELKEYNTLLSDMETTYSVAKVCRENKTCHPLDPDLTDIMATSRDYDELLFAWKGWRDASG
KKMRNNYKRYVELSNKAAMLNGYKDNGAYWRSLYETSTFEEDLERLYLQLQPLYLNLHAY
VRRALYKKYGAEHINLKGPIPAHLLGNMWAQSWSNIFDLVMPFPDATKVDATPAMKKQGW
TPKKMFEESDRFFTSLGLIPMPQEFWDKSMIEKPADGREVVCHASAWDFYNRKDFRIKQC
TVVNMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAVGDVMALSVSTPKHLHSI
NLLDQVMENKESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDRRIKENEYNKEWWNLRM
KYQGLCPPAPRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCDAAGHKGPLHTC
DIYXXXXXXXXXXDALKLGFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLEKENTKN
GEVLGWPEYSWTPYTVQDDSSKTDFLGMSLTKSQATAGGWVLLALALIFLITTIFLSVKF
FSSRREAFKSISEMELK
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcggcgctggggctgctgctctggctgagcctcgcaggcgccctccggcccggc
ctcgagcccccccggcacgagcccaccgagcaaggggccgccctgttcgccagcgactac
aacaccacggccgagatcgtcctcttcgacagcgtctcggccagctggaattacagcacc
aaccttacggccgaaaatgctgctctgcaggtcacagcatcactggaggagcagaacttc
acagagctatgggggaagagagccaaggaactctatggcgacaagtggagtaacttcagt
gatccccagctgaggaagatcattggatcaatccagaccttgggaccctccaacctgccc
ctggagctgagagagaagtacaacaccatcctgagcgacatggacaaaatctactccacg
gccaaggtgtacctgcccaacggcacctgctgggacctggagccagacctctcggacatc
atggccacctcccgcagctacaagaagctgctgtacgcctgggaggggtggcacaacgct
gcggggaacccgctgcgccccaagtatgaggagttcgtgaagctgagcaacaaagcctat
ttggaggatggattcaatgacacaggcagctactggcgctcctggtacgattcagactcc
tttgagaaggacctggagcacatctaccaccagctggagccactctacctcaacctgcac
gccttcgtccggaggaagctgtatgaccgctatgggcccaaatacatcaacctgaagggt
cccatccctgctcacctcctggggaacatgtgggctcagcagtggaacaacatctatgac
ctgatgatcccctaccctgagaagcccagccttgatgtcacgagcaccatggtgcagcag
ggctggaatgccactcacatgttccgggtctcggaggagttcttcacctccctggggctt
ctggagatgcccactgaattctgggagaagtccatgctggaaaagccgacggatgggcgg
gaggtggtgtgtcatgcctcggcctgggacttctacaaccgcaaggacttcaggatcaag
cagtgcacatcggtgaccatggagcagctgttcacagtgcaccacgagatgggccacatc
cagtattacctgcagtacaaggaccagcccgtgtccttccgcagcggggccaatcctggc
ttccatgaggccattggtgatgtcctgtccctctctgtctccacccccagccacctcaag
aaaattggtctcctcagtaatgctactgaggatgaagagagcaatatcaactacctgctg
aagatggccctggagaagattgccttcctgccctttggctacctcatcgaccaatggcgc
tggaacgtgttcagtggccacacgccgccaagccgctacaactacgactggtggtatctg
agaaccaaataccagggcatctgcgctcctctttcaaggaatgagagcaactttgaccct
ggagcaaagtaccacatcccagggaacactccttacatcaggtactttgtgagcttcatc
ctccagttccagtttcacaaggcactgtgccaggcagccaaccacaccggttccctgcac
acctgtgacatctacaggtccaaagaggctggagccaaactcagggaagtgttgaaagct
gggtcctcgaagtcgtggcaggatatcctcttgaatctcactggcacaggtcagatggat
gctgaaccccttctggagtatttcagccctgtcaccaagtggcttcaggagcagaacaac
aagaccaatgaggtgctgggctggcctgagtttgactggcgtccccctgtccctgaaggc
taccctgaaggcattgacaaaatagcagatgaggcacaagccaaagagttcttgtctgag
tacaacagcacagctgagcaagtgtggaatgcctacacagaggcatcctgggcctacaac
accaacatcactgaccacaacaaggagatcatgctggagaagaacttggccatgtccaag
cacaccctggagtatggcatgagggccaggcagtttgacacctccgatttccaggacgaa
agtgtcacccgcattctcaagaagctgagtgtcatcgagagggcagccttacctgagaat
gagctgaaggagtataataccctcctctcagatatggagaccacatacagcgtggccaag
gtctgcagagagaacaaaacctgtcacccactggatcctgacctcacagacatcatggcc
acctctcgggactatgatgagcttctctttgcctggaagggctggcgggatgcttctggg
aagaagatgaggaacaactacaagcgatatgtggaactgagcaacaaggccgccatgctc
aatggctacaaggacaatggggcctactggagatccctgtatgagacatccaccttcgag
gaagatctggagaggctgtatctgcagctgcagcccctgtacctcaacctacatgcctat
gtacgccgagccctctacaagaagtatggtgcagagcacataaacctgaagggtcccatc
cctgcccatctgctaggcaacatgtgggctcagtcatggtccaacattttcgacctggtg
atgcctttcccagatgccaccaaggtggatgccaccccagccatgaaaaaacagggctgg
acacccaagaaaatgtttgaagagtcagaccgtttcttcacctctttgggcctcatccca
atgccacaggagttctgggacaagtccatgatcgagaagccagcggatgggcgggaggtg
gtgtgtcacgcctcggcctgggatttctacaatcgcaaggacttcaggatcaagcagtgc
accgtggtgaacatggatgacctgatcacagtgcatcatgagatgggccacgtccagtac
ttcctgcagtacaaggaccagcctgtctccttccgcgacggggccaaccctggtttccat
gaggctgttggagatgtcatggcattgtctgtctccacccccaaacatctccatagcatc
aatctgctggaccaagtaatggaaaacaaagaaagtgatattaactatctgatgagcatc
gccctggacaaaatcgccttcctgccttttggatacctcatggaccagtggcgctggaag
gtgtttgataggcggatcaaggagaatgagtacaacaaggagtggtggaacctcaggatg
aagtaccagggcttgtgccctccagcaccgaggtctgaagatgactttgaccccggggca
aagtttcacattcctgccaacgtcccttacattaggtatttcgtcagctttgtgatccag
ttccagttccaccaggcactctgtgatgcagctgggcacaagggtcccctgcacacctgt
gacatctacnnnnnnnnnnnnnnnnnnnnnnnnnnnngggatgccctgaagctgggtttc
agcaagccatggcccgaagccatgcagcttatcacagggcagcccaacatgtcagcagag
gccctgatgagctacttcgagccactcatgacgtggctggagaaagagaacacgaagaac
ggggaggtcctgggctggcccgaatacagctggactccttacacagtccaagatgattcc
agcaaaactgatttcctgggaatgtccctgaccaaaagtcaagccacagctgggggctgg
gtcctgcttgccctggcactcatcttcctgatcaccaccatcttcttgagtgtcaagttc
ttctcaagcaggagagaggccttcaaatccatctcagaaatggaactgaaataa

DBGET integrated database retrieval system