KEGG   Taeniopygia guttata (zebra finch): 100217978Help
Entry
100217978         CDS       T01082                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00010  Glycolysis / Gluconeogenesis
tgu00053  Ascorbate and aldarate metabolism
tgu00071  Fatty acid degradation
tgu00280  Valine, leucine and isoleucine degradation
tgu00310  Lysine degradation
tgu00330  Arginine and proline metabolism
tgu00340  Histidine metabolism
tgu00380  Tryptophan metabolism
tgu00410  beta-Alanine metabolism
tgu00561  Glycerolipid metabolism
tgu00620  Pyruvate metabolism
tgu01100  Metabolic pathways
Module
tgu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100217978 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    100217978 (ALDH2)
   00620 Pyruvate metabolism
    100217978 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100217978 (ALDH2)
   00561 Glycerolipid metabolism
    100217978 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100217978 (ALDH2)
   00310 Lysine degradation
    100217978 (ALDH2)
   00330 Arginine and proline metabolism
    100217978 (ALDH2)
   00340 Histidine metabolism
    100217978 (ALDH2)
   00380 Tryptophan metabolism
    100217978 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100217978 (ALDH2)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100217978 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 100217978
NCBI-ProteinID: XP_002196279
Ensembl: ENSTGUG00000006552
LinkDB All DBs
Position
15
AA seq 520 aa AA seqDB search
MLRAAVRGSRLCPALLRAPFSAAAASPIPAPNPRPDIAYNKIFINNEWHDAVSKKTFPSI
NPATGEVICQVAEGDKADVDKAVKAAQAAFQLGSPWRRMDASHRGKLLNRLADLIERDRA
YLAALETLDNGKPYAISYLVDLDMVVKCLRYFAGWSDKFHGKTIPLDGDFFCYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLSALYVASLIKEAGFPPGVVNI
IPGYGPTAGAAISSHMDVDKVAFTGSTEVGHLIQKAAAESNLKRVTLELGGKSPNIIMSD
ADMDWAVDQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSVEKAKARVVGNPFDFKTE
QGPQVDEEQFKKILGYISTGQREGAKLLCGGNPAADRGYFIQPTVFGDVQDSMTIAREEI
FGPVMQILKFRTIEEVIQRANDSKYGLAAAVFTKDLDKANFVSQSLRAGTVWINCYDVFG
AQAPFGGYKASGNGRELGEYGLEAYVEVKNVTIKIPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggcggcggtgcgcggctcccggctctgcccggccctgctccgggctcccttc
tcggccgccgccgcctcccccatcccggcgcccaacccgcgccccgacatcgcctataac
aagattttcataaacaacgaatggcacgatgcagtcagcaagaaaaccttcccctccatc
aacccagccacaggagaagtcatctgccaggtggctgagggcgataaggcagatgtggac
aaggcagtgaaggcagcccaggcagcgttccagctgggctctccctggaggaggatggat
gcgtctcaccgcgggaagctgctgaaccgtctggctgacctgatcgagagggaccgcgcc
tacctggccgccctggaaactctggataatggcaaaccctacgccatctcctacctggtg
gatttggacatggtggtcaaatgtctcagatactttgcaggctggtcagataaattccat
ggcaaaaccatcccgttagatggagacttcttctgctacacaagacatgagcccgtggga
gtctgtgggcaaatcatcccatggaacttcccactgttgatgcaagcatggaaactgggg
cctgccctggccactgggaatgtggttgtgatgaaagtggcagagcaaacccccctgagt
gctctctatgtggccagtctgatcaaagaggctggattccccccgggcgtggtgaacatc
atccctggctatggacccacggcaggagctgccatctcctcccacatggacgtggacaaa
gtggccttcaccggctccacggaggttggacacctgatccaaaaggctgcagcagagagt
aacctcaagagggtgaccctggagcttggagggaagagcccaaatatcatcatgtctgat
gcagacatggactgggctgtggatcaagcccactttgccctgttcttcaaccaagggcag
tgctgctgtgcagggtccaggacctacgtgcaggaggacatttacaacgagtttgtggag
aggagcgtggagaaggccaaggccagggtggttggaaacccctttgacttcaaaaccgag
caggggcctcaggtggatgaggagcagttcaagaagatcctgggctacatcagcaccggg
cagagggagggagccaagctgctgtgtggtggcaaccccgctgcagacaggggctacttc
atccagcccacggtctttggggacgtgcaggacagcatgaccatcgccagggaggagatc
tttgggccggtgatgcagatcctgaaattcagaaccatcgaggaggtgattcagagagcc
aacgactccaagtacggcctggcagccgccgtgttcaccaaggacctggacaaagccaac
tttgtgtcgcagagcctgagggctggcacggtctggataaactgctatgacgtgtttggt
gcccaggctccctttggaggctacaaagcctctgggaatgggagggagctgggggagtac
ggcctggaggcttatgtggaggtgaaaaatgtgacaatcaaaattccacagaaaaactcc
taa

DBGET integrated database retrieval system