KEGG   Taeniopygia guttata (zebra finch): 100218244
Entry
100218244         CDS       T01082                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04020  Calcium signaling pathway
tgu04260  Cardiac muscle contraction
tgu04261  Adrenergic signaling in cardiomyocytes
tgu04270  Vascular smooth muscle contraction
tgu04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100218244 (CACNA1C)
   04020 Calcium signaling pathway
    100218244 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100218244 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100218244 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    100218244 (CACNA1C)
   04270 Vascular smooth muscle contraction
    100218244 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tgu04040]
    100218244 (CACNA1C)
Ion channels [BR:tgu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100218244 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 100218244
NCBI-ProteinID: XP_030119732
LinkDB
Position
1A
AA seq 2201 aa
MVNENKRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTASSTQRKRQQYGKQKKQGTTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGNSIGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYH
VQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTECKAGWEGPKHGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNRSPPAGLPDEKKGKFA
WFSHSTESHVSMPTSETESVNTDNVPGADMEGENCGARLAHRISKSKFSRYWRRWNRFCR
RKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLK
MYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYW
NSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQ
SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD
NLADAESLTSAQKEEEEEKERKKLARTASPEKKQEMEKTAVEEETKEEKIELKSITADGE
SPPATKINVDDYQPNENEEKSPYPTTEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAVPM
PDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSFRNQILG
NADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVV
KILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGK
LYSCTDSSKQTEAECRGYYITYKDGEVSQPMIQPRSWENSKFDFDNVLTAMMALFTVSTF
EGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGE
QEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTI
CLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIAFKPKGYFSDPWNVFDFLIVIGS
IIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSSSMNAEENSRISIT
FFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIA
LNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPDKKCDPESEPANSTEADHS
CGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDP
EAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALV
RTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQE
YFRKFKKRKEQGLVGKPSQRNALSLQFAVLQAGLRTLHDIGPEIRRAISGDLTAEEELDK
AMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSGFPQTFTTQRPLHINKSGNNHGDTE
SPSHEKLVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPNYPSTVSTVEGHGTPLSPT
ICVQEAPWKLPSKRTHYYETLGRSSSRDSQLAIVCQEEVSQDETYDENLNEDIEYCSEPS
LLSTEMLAYQDDENRQLTPPEHNKGEDTRHSPKKGFLCSSALGRRASFHLECLKRQKNQG
VDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTMFSRLCATPPATPCNRGWPQQSIPT
LRLDGAESSEKLNSSLPSVHCGSRYPESGGSPRRARPVSLTVPSPTAGSSRQFHGSASSL
VEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMENAADNILNGNSKQSPNGNLLP
FANCRDPGQDSAGEEEEEVQNPDCRISQEELKDSRIYISSL
NT seq 6606 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacaagaggatgtacattccagaagaaaaccatcaaggttccaactat
gggagtccccgcccagctcatgccaacatgaatgccaatgcagctgcagggcttgcccca
gagcacatccccactccgggggcagctctgtcctggcaggctgccatcgatgccgccagg
caagccaagctgatgggcagcgctggcaacgccacgatatccacggccagctccacgcag
aggaagcggcagcagtatggcaagcagaagaagcagggcaccaccacagccacccgtcct
ccccgggcgctgctgtgcctcacgctgaagaatcccatccggagggcgtgcatcagcatc
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagctatctatatcccctttccagaagatgattccaatgccaccaattccaatctggaa
cgagtggaatatctctttctcataatttttacagtggaagcatttttaaaagtaatagca
tacggacttctctttcaccccaacgcttacctccgcaatggctggaatttactagatttt
ataattgtggtagtagggctttttagtgcaattttagaacaagcaaccaaagcagatggg
gggaattcaataggaggaaaaggtgccggattcgatgttaaagctctgcgggctttccga
gtactacgtccactacggctggtgtctggagttcctagtctccaggtggttttaaattca
attatcaaggccatggtccctttgttgcatattgccctgctggtgctgtttgtcattatt
atctatgccatcattggactggagttattcatggggaagatgcataagacctgctaccat
gtgcaagggggactgatagatacacctgcagaagatgatccatctccgtgtgccccccag
tctgcccacgggcggcagtgtcagaacggcaccgagtgcaaggcgggctgggagggaccc
aagcatggcattaccaactttgacaattttgcttttgccatgctcacggtgtttcagtgc
atcaccatggagggctggacagatgtgctgtactggatgcaggacgctatgggctatgag
ttaccatgggtgtattttgtcagtctggtcatctttggatcctttttcgttctaaatctg
gttcttggtgtgttgagcggggagttttccaaagaaagagaaaaggctaaagctcgaggt
gatttccagaagctacgggaaaagcagcagctcgaggaggatctgaagggatacttagac
tggataactcaagcagaagatattgatccagaaaatgaagatgaaggcatggatgaggag
aagcctcgaaacagaagccctccagctggtttgcctgatgagaagaaaggaaagtttgct
tggtttagtcactccacagaaagccatgtgagcatgcccaccagcgagaccgagtccgtg
aacaccgacaacgtccccggagcggatatggaaggcgagaactgcggcgcaaggctggcg
catcggatctcaaaatcaaaatttagtcgctactggcgccgatggaatcgattctgcaga
aggaagtgccgtgctgctgtcaagtccaatgttttctattggctggtgatcttcctcgtg
tttctcaacactctcaccattgcctctgagcactacaaccagccagactggctcacagag
gtccaagacactgccaataaggtgctgctagctcttttcacggcagagatgttgctgaag
atgtacagcctcggtctccaggcctactttgtgtccctgttcaaccgctttgactgtttc
attgtgtgtggaggcatcctggaaaccatcctggtggagacgaagatcatgtcaccactg
ggcatttcggttttgagatgtgtgagactcctaagaatatttaaaatcacaagatattgg
aattccctgagtaatcttgtggcttcgcttctgaattcagtccgctccattgcttccctg
ttgctgcttctcttcctcttcatcatcatcttctcactcctggggatgcagctctttggg
ggcaagtttaactttgatgagatgcagaccaggaggagtacatttgacaacttccctcag
tccctcctgactgtgtttcagatcctgactggggaggactggaattcggtgatgtatgat
gggatcatggcttatggcggcccctcttttccaggaatgttggtctgtatttacttcatc
atcctcttcatctgtggaaactatatcctgctgaatgtatttttggccattgctgtggac
aaccttgctgatgctgagagtttaacatcagcacagaaagaggaggaagaggaaaaagaa
aggaaaaagctagctaggactgctagtcctgaaaaaaaacaggagatggaaaaaacagct
gtggaggaagagacaaaggaggagaaaattgagctgaaatcaatcactgctgatggagag
tccccacctgctaccaagatcaacgtggatgattatcagcccaatgaaaatgaagaaaag
agcccttatcccacaacagaagcaccagcagaggaagatgaggaagaacctgagatgcct
gtcggccctcggcctcgcccgatgtctgagctgcacctcaaggaaaaggctgtgcccatg
cctgatgccagtgcttttttcatctttagtcctaacaacaggtttcgtgtccactgccat
cgaatcgttaatgataacattttcaccaacctgatcctgtttttcatcttgctcagcagc
atctccctggcagctgaggaccccgtgcgacacctctcctttaggaaccaaatcctaggc
aatgcagactatgtcttcactagtatctttacattagaaattattcttaagatgaccgcc
tacggggctttcctccacaagggctccttctgcaggaactatttcaacatcttagacctg
ctggtggtcagcgtttcgctcatctcctttggcatccagtccagtgccattaatgtggtg
aagatcctgcgtgttctgcgggtccttagaccactgagggccatcaacagagccaaagga
ctaaagcacgtggtccagtgtgtgtttgtcgccatccgaaccatcgggaacattgtgatt
gtcaccactttgctgcagttcatgtttgcctgcattggagttcagctgtttaagggcaag
ctgtacagctgcactgacagctccaagcagacagaagcagaatgcagagggtactacatc
acctacaaggatggggaggtcagccagcccatgatacagccccggagctgggagaacagc
aagttcgacttcgacaacgtcctcactgccatgatggccctcttcaccgtctccaccttt
gagggctggccagagttgctgtataggtccattgattcccacatggaggatgtgggaccc
atctataatcacagggttgagatctccatcttctttattatctacatcatcatcattgct
ttcttcatgatgaacatcttcgttggtttcgtcatcgtcacatttcaggaacaaggagaa
caagagtacaagaactgtgagctggacaaaaaccagcgccagtgtgtagagtatgccctg
aaagcccggcctctgcggagatacatccctaaaaaccagtaccagtacaaagtttggtat
gtggtcaactccacctactttgaatacctgatgttcgttctgatcctgctgaacaccatc
tgcctggccatgcaacactatggtcagagctgcatgttcaaggaagccatgaatatcctc
aacatgctcttcaccggcctcttcactgtggagatggtcctgaaattaatcgccttcaaa
cccaagggttactttagtgatccttggaatgtttttgacttcctcatcgtaattggcagc
attatagacgtcattctcagtgaaactaatcactatttctgtgatgcatggaatacattt
gacgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtgaacccagct
gaacatacccaatgctcttcctctatgaacgcagaggaaaactctcgcatctcaatcacc
ttcttccgactcttccgcgtgatgcgtctcgtgaagctcctgagccgaggggagggcatc
cggacactcctttggaccttcatcaagtccttccaggctctcccctacgtggctctttta
atagtgatgctgttcttcatctacgctgtgattgggatgcaggtgtttggtaaaattgcg
ctgaacgataccacagaaatcaaccgcaacaataacttccagaccttcccccaggcagtg
ctgctgcttttcaggtgtgccacaggtgaggcctggcaggaaatcatgctggcatgtctc
cccgacaagaagtgcgacccggagtcggagccggccaattccacggaagccgatcactcg
tgtggcagcagcttcgccgtcttctatttcatcagcttctacatgctctgtgccttcctg
atcatcaatctttttgtagctgttataatggataactttgattacctgacacgggactgg
tccattttaggaccacaccacctggatgagtttaaaaggatctgggcagagtatgaccct
gaagctaagggacggatcaaacacctggacgtggtgaccctgctccggcggatccagccc
ccactgggcttcgggaagctctgccctcaccgagtggcttgcaaacgccttgtctccatg
aatatgccactgaacagtgatgggactgtcatgttcaatgccactctctttgcattggtc
agaacagcactgaggatcaagacagaaggtaacctggagcaagccaacgaagagctgaga
gcaataattaagaaaatctggaagcgcaccagtatgaagctgctggaccaggtggtgcct
cctgcaggtgatgacgaggtgaccgtggggaagttctacgccactttcttgatccaggag
tatttccggaagttcaagaagcgtaaagagcaggggctggtggggaagccctcgcagcgc
aacgcgctgtccttacagtttgctgttttgcaggctggtctgcgcacactccacgacatt
gggcccgagatccgacgagccatttctggagacctgacagctgaagaagagctggacaag
gccatgaaagaagctgtttctgctgcctctgaagatgatatcttccggagagctggaggc
ttgtttggaaaccatgtgagctattaccaaagtgacggcaggagtgggttcccccagaca
ttcaccacccagagacctttgcacatcaacaagtctggcaacaaccatggagataccgag
tctccatctcacgagaagctggtggattccaccttcacgcccagcagctactcatcttca
ggctccaatgccaacatcaacaatgccaacaacacggccctgtgtcgcttccccagccca
cccaactaccccagcactgtcagcacggtggaaggccatgggacccccctgtcacccacc
atatgtgtgcaggaggctccctggaaactcccatccaaaaggacacattactacgagaca
ctgggacgctccagttccagagacagccagctggcaattgtttgccaagaggaagtgtct
caggatgagacttacgatgaaaatttgaatgaagacattgagtactgtagtgaaccaagt
ctgctctctaccgaaatgcttgcataccaagatgatgaaaacagacaactcactccacca
gaacacaacaaaggagaggacaccaggcactctccgaagaaggggtttctgtgctcctca
gctctaggtcgaagagcatcttttcatttagagtgtttgaaaagacagaaaaaccagggt
gtggatgtctcacagaagacagtcctgcctttgcatctggtccatcatcaggcattagca
gtggccggcctgagtcccctgctccagcgaagccattcccccaccatgttctctcggctg
tgtgctacacccccggccacgccttgcaaccggggttggccgcaacagagcatcccaacg
ttgcgcctcgacggggccgagtcctcggagaagctcaacagcagcttgccatcggtgcac
tgcggctcccggtacccggagagcggcggcagccccaggagagcccggccggtgtccctg
accgtgcccagcccgaccgcagggagcagccggcagttccacggcagcgccagcagcctg
gtggaagcggtcttgatttcggaaggactgatgcagtttgctcaagatccaaagttcatt
gaggtcacaacccaggagctcgcagacgcctgcgacatgacgatagaagagatggaaaat
gcagcagacaacattctcaatggtaacagcaagcagagccccaatggcaacctcttgcct
tttgctaactgcagggacccagggcaggacagtgcaggagaggaagaggaagaggtgcag
aacccggattgtaggataagtcaggaggagctcaaggacagcaggatttatatcagcagc
ctgtag

DBGET integrated database retrieval system