KEGG   Taeniopygia guttata (zebra finch): 100218386
Entry
100218386         CDS       T01082                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04020  Calcium signaling pathway
tgu04144  Endocytosis
tgu04510  Focal adhesion
tgu04540  Gap junction
tgu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100218386 (PDGFRA)
   04020 Calcium signaling pathway
    100218386 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100218386 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100218386 (PDGFRA)
   04540 Gap junction
    100218386 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100218386 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tgu01001]
    100218386 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tgu04090]
    100218386 (PDGFRA)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100218386 (PDGFRA)
Protein kinases [BR:tgu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100218386 (PDGFRA)
CD molecules [BR:tgu04090]
 Proteins
  100218386 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Herpes_gE Adeno_E3_CR1 Kinase-like
Other DBs
NCBI-GeneID: 100218386
NCBI-ProteinID: XP_030126938
Ensembl: ENSTGUG00000007756
LinkDB
Position
4
AA seq 1087 aa
MGTYPQMLLILGCFLTGPFLTFCQLPLPTIVPNRNEMVVQLYSNFTLKCSGDSEVSWQYP
VTEGNHRIDIRHEENNSGFFVTVLEVGNASAAHTGLYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPAVIPCRTSDPDAQVTLVNNLDKPVHALYDTKQGFIG
NFPAGSYMCKTMVKGVEFKSDEFLIYIIRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVAITVHDKGFVHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTTSGRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALISAL
VDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCNNDTSWTILTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSMSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacttacccacagatgctcctgatcctgggatgtttcctcacaggaccattccta
acattttgccagcttcctctgccaactattgttcccaataggaatgaaatggtggtacag
ctgtattccaatttcacactcaaatgctctggagacagcgaagtgagctggcagtaccca
gtgaccgagggaaaccacaggatagacattagacacgaagagaacaacagcggcttcttc
gtgacagtgctcgaagtaggaaatgcctcggctgcccatacgggcttgtatgtttgctac
tataaccacacacaagtggaggatggggaggtggaagggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttctataccagaagaccagttcatcctagtagaa
gaaggtgatcctgcagttatcccttgtcggacaagtgacccagatgctcaagtgacttta
gttaacaatttagacaagcctgtgcatgctttatatgacaccaaacaaggcttcataggg
aattttcctgcaggctcatacatgtgcaaaacaatggttaagggcgtggagttcaagtct
gatgagttcctcatctatatcataagagctacttcacagctgcctgttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcctgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtgccatcgcagaagctggtttacaccctgaccattcctgaggca
tcagtgaaagacacaggcgattatgaatgtaccgctcggcatgcaaccaaggaggttaag
gaaaataagaaagtagccattacagttcatgacaaaggctttgttcacctggagcctcag
ttcagccctctggaagctgtcaacctgcatgaagtcaaaaactttgttgtcgatgtgcag
gcttacccagcaccaaaaatgtactggttgaaggataatgtgactctgattgaaaatctt
acagagattgttactacatcaggaagagtccaggaaacgaggtttcagagtattttaaaa
ttgatacgggccaaggaggaagacagtggatactatactttggttgctgaaaatgaagat
gagattaaaagatacaccttctcattgctcatacaagttccagctctgatctcagccctc
gtggatgatcaccatggctctgcaggtgggcagacagtgagatgcttggcagaggggacc
ccacttcctgatgtggaatggctggtttgcaaggacattaaaaagtgcaacaatgacacc
tcatggaccattttgactaacaatatctctgatatacatatggaagcccacttggatgag
aaaaatatggtggaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgcga
tgtgtggcgaggaatgacctcggtgctgttactcgagaactgaagcttgtggctcccacc
ttgaggtcagagctaaccgtggctgctgctgtcttagtgctgttagtgattgtgataatt
tccctgattgtcctggttatcatatggaaacagaagccaaggtatgagattagatggaga
gtcattgagtctattagccctgatggccacgagtacatttatgtggacccaatgcaactg
ccttatgactccagatgggagtttcctcgagatgggttagtgcttggtcggatccttggt
tcgggagcatttggaaaagtagttgaagggactgcatatggattgagtcgctctcaaccg
gtgatgaaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggca
ctcatgtctgaactgaaaataatgacacatcttggcccccacttgaatattgtgaatctg
cttggagcttgtacaaaatcaggtcctatttacatcattactgaatactgtttttatggc
gatttggtgaactacctgcataagaatagggacaatttcctgaaccgacacccagaaaag
cctaaaaaagatttggatatctttgggatgaaccctgctgatgaaagcacaagaagctat
gtgatactatcgtttgaaaacactggagaatacatggacatgaaacaagctgataccact
cagtatgtgccaatgctggaaaggaaggagggctctaaatactctgatattcagagatct
gtgtatgatcggcctgcttcatataagaagaaatccatgtcagaatcagaagtcaaaaac
cttctttcagatgatagttcagagggcctcagcctactggatttgctgagcttcacctac
caggttgcacggggaatggaattcttggcttctaagaattgtgtgcaccgtgacttggcc
gctcggaatgtcctcctggctcaaggaaaaattgtgaagatctgtgactttgggctggct
agagacatcatgcatgattccaactatgtctccaagggcagtactttcctcccagtaaaa
tggatggcacctgaaagtatttttgacaacctgtacacaacattaagtgatgtctggtct
tatggcattctgctgtgggaaatattttctcttggtggcacaccgtatcctggcatgatg
gtcgattctactttctacaataagataaagagtggatatcgaatggccaaacccgatcat
gctaccaatgaagtgtatgagattatggtgaagtgctggaacagtgaaccagagaaaaga
ccttctttctaccatttgagtgaaattgtggagagcttgttgcctggagagtacaaaaag
agctatgagaagattcatctggacttcctgaaaagtgaccacccagctgtcacacgcatg
agaggggactgtgacaatgcttacattggtgtaacttacaagaatgaagacaagctaaag
gacagggagagtggatttgatgagcagaggctgagtgctgacagtggatacatcattccc
ctgcctgacattgaccctgtttctgaagatgagcttggcaaaagaaacagacacagttca
cagacatctgaagaaagtgccattgaaactggttccagtagctctaccttcatcaagaga
gaggacgagaccattgaggacattgacatgatggatgacattgggatcgactcctcagac
ctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system