KEGG   Taeniopygia guttata (zebra finch): 100218541Help
Entry
100218541         CDS       T01082                                 

Definition
(RefSeq) leukotriene C4 synthase-like
  KO
K00807  leukotriene-C4 synthase [EC:4.4.1.20]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00590  Arachidonic acid metabolism
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100218541
Enzymes [BR:tgu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.20  leukotriene-C4 synthase
     100218541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 100218541
NCBI-ProteinID: XP_012430148
Ensembl: ENSTGUG00000001074
UniProt: H0YS49
LinkDB All DBs
Position
13
AA seq 145 aa AA seqDB search
MLDQIHWLAAVTVLGVLEQAYFLLQVIYARRLFGISPPKTSGPPEFERIFRAQVNSSEYF
PIFLAVLWQAGLFFHQGLAAALGLLYLYARYCYFMGYKASSSERLAPIYFSAGVLWILIA
VSALGILCFFLSHYVGLNIFQRLTA
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcagattcattggctggctgctgtgacagtcctgggagtcctggagcaagcc
tacttcttactgcaggtgatctatgctaggaggttgtttggcatttcacctccaaagacc
tcaggccctcctgaatttgaaaggatctttcgagcacaggtgaactcctctgagtatttt
cccatcttcctggcagttctgtggcaggctggactcttcttccatcaaggtctggctgca
gccttgggtctgctctatctctacgcccgctactgctactttatgggatacaaggcatca
tcctcagaaagactcgccccgatatacttcagcgctggagttctctggattctcattgcg
gtgtcagccctgggcatcctgtgtttcttcctctctcactatgtggggctgaacatcttc
cagcgtctcacagcatga

DBGET integrated database retrieval system