KEGG   Taeniopygia guttata (zebra finch): 100218747
Entry
100218747         CDS       T01082                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04012  ErbB signaling pathway
tgu04020  Calcium signaling pathway
tgu04068  FoxO signaling pathway
tgu04510  Focal adhesion
tgu04540  Gap junction
tgu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100218747 (EGF)
   04012 ErbB signaling pathway
    100218747 (EGF)
   04068 FoxO signaling pathway
    100218747 (EGF)
   04020 Calcium signaling pathway
    100218747 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100218747 (EGF)
   04540 Gap junction
    100218747 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100218747 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tgu04052]
    100218747 (EGF)
Cytokines and growth factors [BR:tgu04052]
 Growth factors
  Growth factors (RTK binding)
   100218747 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b cEGF FXa_inhibition EGF_CA EGF EGF_3 DUF5050 SGL hEGF
Other DBs
NCBI-GeneID: 100218747
NCBI-ProteinID: XP_002195264
Ensembl: ENSTGUG00000004206
LinkDB
Position
4
AA seq 1253 aa
MFLFLVAFLPVVFKIGFVSLSALQHWNCPNGYRLKPENSACVDIDECLEGGLGTCGQTCI
NIPGSYICSCLPGYSLGIDKQSCYVNDPAPFLLFSHGNAIFRIDTEGTNHERLVSDTGPS
TLMDFHYIEEKVYWVDSERRLLQRINLNGKKRERLCYIDKGISGFAIDWINQDILWANRQ
KGTIEVTDMNGKKRRVLLRAVGRPTRITIDAEQRLLFMSSDGTVSSIYRASLSGSDMINI
LKTTEKIKAISLDLVDTKLYWIQHDHGKEISHIGSCDYDGGGVRFLRNSVRHQLLAMSLF
AEHLYYSDLKSGMIWRANKYTGNVVVTISLKPSFFPPVEIKIVHPFKQPGAKIDSQDLEK
GICDLNREKCRRRICSPDSRTHRCKCSSGFILSRNKQFCEDINECGFWNHGCTLGCVNIP
GSYYCTCPRGFVLLPDRKTCHELITCTSNDNGCSHGCLQTSKGPVCFCPEGSVLKVDGKT
CTGCTSPDNGGCSQICSSLSPSSWECACFPGYKLQRDRKHCTAIGPKPFLLFANGQDIRQ
ISFDGTDYTSLLDWQMGVVLALDSDPVENKIYFAHTALKWIERANLDGSDREKVVHGAID
TPEGLAVDWINRKLYWTDRGKVCIERSNLNGMQRKMIIWEDLSQPRGIAIHPFAKRLFWT
DMGVNPRIDSSSLDGFDRRVVASSGLVWPSGIALDYLADKLYWCDAKRAVVESANLDGSG
RRILAQNDVGHPFAVAVFEDHLWFSDWARPSLVRVDKKTGQNRVRLRGSMLRPSSVLVVH
PLAKPGTNPCLYENGGCHQICENNFGIVHCKCHPGFGKTQDGKSCHALDSSNSTAGSVSV
HKEVMPVPPPETVLQSTRSTGIFKDADNGEKQKIIYFTAEIMVSDEDDCTALECYVNAEC
VLLEDGAMCQCLKGFTRKGKSCYDVDECAVHMDRCNRSVADCINTEGGYVCKCLEGYTGD
GVHCYDIDECKTGSHTCGENMTCTNTEGNFTCSCADHASGTGAGCKSTVPPAAASNEYTT
KAVQGDFVGCPPSYESYCLHGGVCNYVSDLQDYACNCVTGYVGERCQFSDLEWWEQRRAG
RAKVRSIAISAGAAGLALLLLLLAVLAAYCRRTQNLYKKNLCAEAIRAASSRADESVTPT
GNKSLFAVFKEGNSSLENKAVDLIECETAEPHPACPSESEEEQPVTYDKAAETLAEEEKE
QGHRKEGPAGEKLRQPMAAVKVPPQAPWSIHPNPLPEREPCSLAPDSLLMQPD
NT seq 3762 nt   +upstreamnt  +downstreamnt
atgtttctcttccttgttgcttttttgccagtggtttttaaaattggttttgtcagcctc
tcagctctgcagcactggaactgtcctaatggatacagattaaagcctgaaaactctgct
tgtgtagatattgatgagtgccttgaaggtggtttgggaacctgtggccaaacctgtatc
aatattccagggtcgtacatctgctcctgtttgcctggttactccttgggtattgacaag
cagtcttgctatgtgaatgatccagcaccattcctgctttttagccatggaaatgccatc
tttagaattgacactgaagggacaaatcatgaaagattggtttctgatactggcccatca
acacttatggattttcattatatagaagagaaagtgtattgggtagactctgaaaggcga
ctacttcaaagaattaatctaaatggcaaaaaacgagagagactatgttacatagacaaa
ggcatttcaggctttgctattgactggataaatcaagacattctctgggccaacagacag
aaaggaaccatagaagtaaccgacatgaatgggaagaaacgccgagttcttctaagagct
gttggccgtcccacaaggattaccattgatgctgaacaaaggctgttatttatgtcttca
gatggtacagtttccagcatataccgagcgtccctcagtggaagtgatatgataaatatt
ttgaaaactacagaaaaaataaaggccatctcactagatttggttgacacaaagctctac
tggatccaacatgaccacggaaaagagatttcccacattggatcatgtgactatgatggt
ggaggtgttcgtttcctcagaaattctgtccgacatcagttgcttgctatgtctctcttt
gctgagcacctgtactactcagacttgaagtctggcatgatatggagagccaacaaatat
actggaaacgttgtagtcacaattagcctgaagccatcatttttcccaccagtggagata
aaaatagtacatccatttaagcagccaggtgcaaagattgattctcaggatttggaaaaa
ggaatctgtgatttgaacagagaaaagtgcagaagaagaatctgcagcccagactcaagg
acacatcggtgtaaatgttctagtgggtttattttaagtcgaaataaacagttttgtgaa
gacattaatgaatgtggcttctggaatcatggctgcactttaggctgtgtgaacatccct
ggttcctattactgcacctgcccgagaggctttgttctgctgcctgataggaaaacatgt
catgagctaattacctgtacaagtaatgacaacggatgtagtcatggctgccttcagaca
tctaaaggccctgtttgcttttgcccagaaggatctgtactcaaagtagatggcaaaaca
tgcacaggttgcacatctccagataatggtggctgcagtcagatatgctcttctttaagc
ccatcctcctgggagtgtgcttgttttcctggatataagcttcagcgagacagaaagcac
tgcactgctataggtcctaagccatttttgttatttgcaaatggccaagatatccgccag
atcagttttgatggaacagattacacaagtttacttgactggcagatgggagtagtctta
gcactggactctgacccggtggaaaataagatttactttgcccacactgccttgaaatgg
atagaacgagcgaatctggatggttcagatcgtgaaaaggttgttcatggagctatagat
acacccgagggccttgctgtggactggattaaccgtaaattgtactggacagacagaggg
aaggtgtgcattgaaaggagcaatctgaatggaatgcaaagaaaaatgatcatctgggag
gatctctcccagccccgagggattgccatccacccatttgctaagagattattctggact
gacatgggggtcaatccgcggattgacagctcttcattagacggcttcgatcgccgggtc
gtagccagctctggcctggtgtggcccagtggaatagctctcgactacttggctgacaag
ttgtactggtgcgatgctaaacgggccgtggtggagagcgcaaacctggatggttctggt
cgtcgaattcttgcacagaatgatgtaggccacccttttgctgtggcggtgtttgaggac
cacctgtggttttctgactgggctaggccatcactagtgagggtggacaagaagaccggc
caaaacagggtacgtcttcgaggcagcatgctgagaccctcatcagtgcttgtagttcat
cctttggcgaaaccagggacaaatccttgcctttatgagaatggaggctgtcatcagatc
tgtgaaaacaattttggaattgtccactgcaagtgccatccaggatttgggaaaactcaa
gatggaaaatcctgtcatgctctggattcttccaactcaacagcaggaagtgtctctgtg
cacaaggaggtaatgccagtgccaccaccagagactgtactccagagcacacggagcact
gggatttttaaggatgcagacaatggggaaaagcagaaaataatttattttacagctgaa
atcatggtatcagatgaagatgactgcactgcactagaatgttatgtcaatgcagagtgt
gttttgctggaagatggtgctatgtgccagtgtttgaaaggatttaccaggaaggggaaa
tcatgctatgacgtggacgagtgcgctgtgcacatggaccgctgcaatcgaagcgtggct
gactgcatcaacacggaagggggctacgtctgcaagtgcctggaaggctacactggagat
ggagtccattgctatgatattgatgagtgcaagacggggtcccacacctgtggagagaac
atgacctgcacaaatacagaaggaaacttcacttgctcgtgtgctgatcatgcttctgga
actggcgccggttgcaaatctactgttcccccagctgctgccagcaatgagtacactaca
aaggctgtgcaaggtgattttgtaggatgccctccttcgtacgagtcatactgcctccat
ggtggagtgtgcaattatgtttctgacctacaagactatgcctgcaactgtgtgacgggc
tacgtgggggagcgctgccagttcagcgacctggagtggtgggagcagcggcgcgccggg
cgggcgaaggtgcggagcatcgccatcagcgcgggcgccgccgggctggccctgctgctg
ctgctgctggccgtcctggctgcctactgccgcagaactcagaatttgtataagaagaat
ctctgtgcagaagctataagagctgccagcagccgtgctgacgagagcgtaacacctact
ggcaacaagtctctgtttgcggtttttaaggagggtaacagttctctggagaataaagca
gttgatctaattgaatgtgagacagcagagcctcatcctgcctgtccgtcagaatctgag
gaagagcagcctgtaacatatgacaaagcagcagagactttggcagaagaggagaaagaa
caaggccaccgaaaagagggtcctgctggtgagaaattgcgccagccgatggcagcggtg
aaggtccctccccaggctccctggagcatccatcccaatcccctgccagaaagggagcct
tgcagtcttgccccagacagcttgctgatgcagccagactag

DBGET integrated database retrieval system