KEGG   Taeniopygia guttata (zebra finch): 100221118Help
Entry
100221118         CDS       T01082                                 

Gene name
HESX1
Definition
(RefSeq) homeobox expressed in ES cells 1
  KO
K09354  homeobox protein expressed in ES cells 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tgu03000]
    100221118 (HESX1)
Transcription factors [BR:tgu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, XANF
    100221118 (HESX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 100221118
NCBI-ProteinID: XP_012428051
Ensembl: ENSTGUG00000007186
LinkDB All DBs
Position
12
AA seq 206 aa AA seqDB search
MLAEGEGMAGPSLCAATTAASPDLHKVPGLGESKTTPCSFSIESILGLEQKKDGIPAGKP
HRPWMDACTSLVLGDDSNPHLQTPVVCYENPLFHARSDPVQEENVLKCEKYFSVTERLSF
KRELSWYRGRRPRTAFTRNQIEVLENVFKMNSYPGIDIREELARKLDLDEDRIQIWFQNR
RAKLKRSHRESQFLMVKNTFTSSLLE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctggctgagggtgaaggcatggccggtccctcgctgtgtgctgccaccacggcggcc
tctccggacctgcacaaggtgcccggcttgggagagagtaaaaccacaccctgctccttt
tcaattgagagtatattgggactggagcagaaaaaagatggcattccagctgggaaacct
cacagaccttggatggatgcatgcaccagcctggttttaggtgatgacagtaatccccat
ctgcaaacccctgttgtttgctatgaaaatccattatttcatgctagaagtgatccagtg
caagaggaaaacgttttgaaatgtgaaaaatatttttcagttactgaaaggctgtctttc
aaacgagaattgagctggtacaggggtagaagaccaagaactgcattcactagaaaccag
attgaagtcttggaaaatgtttttaaaatgaactcctaccctggcattgatattagagaa
gaattagctcgcaaattagatttagatgaagacaggatccagatctggtttcagaaccgt
cgtgcaaagctgaaaagatcacacagagaatctcagtttctaatggtgaaaaatactttc
acctccagcctgctagagtag

DBGET integrated database retrieval system