KEGG   Taeniopygia guttata (zebra finch): 100221396Help
Entry
100221396         CDS       T01082                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04110  Cell cycle
tgu04114  Oocyte meiosis
tgu04120  Ubiquitin mediated proteolysis
tgu04914  Progesterone-mediated oocyte maturation
Module
tgu_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100221396 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100221396 (CDC23)
   04114 Oocyte meiosis
    100221396 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100221396 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tgu04121]
    100221396 (CDC23)
   03036 Chromosome and associated proteins [BR:tgu03036]
    100221396 (CDC23)
Ubiquitin system [BR:tgu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100221396 (CDC23)
Chromosome and associated proteins [BR:tgu03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    100221396 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_16 TPR_11 TPR_7 ANAPC3 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Motif
Other DBs
NCBI-GeneID: 100221396
NCBI-ProteinID: XP_002191696
LinkDB All DBs
Position
13
AA seq 579 aa AA seqDB search
MAAGGGDFSDLREIKKQLLSVAERSRERGLQHSGKWAAELAFALEPLPLSELPPPPVLTE
EDARDLDAYTLAKSYFDLKEYDRAAYFLQGCKSQKAYFLYMYSRYLSGEKKKDDETVDSL
GPLEKGQVKNEALRELRVELSKKHKAQELDGFGLYLYGVVLRKLDLVKEAIDVFVEAAHV
LPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQSLIDAG
FSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKPELSY
LAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEM
KNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVA
LGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQCYIKYIQDIY
SCGEVVEHLEVSTAFRYLAQYYFKCKLWDEASACAQKCCAFNDTREEGKALLRQILQLRN
QGETSSTDVAAPFFLPASLSATNTPTRRVSPLNLSSVTP
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgggcggcggtgacttctcggacctgcgggagatcaagaagcagctgctgagc
gtggcggagcggagccgcgagcgcgggctgcagcacagcgggaagtgggctgctgagctg
gccttcgccctggagccactgccactgagtgagctgccacctccgcccgtgctcaccgag
gaggatgctcgtgatctggatgcctacacgttggccaagtcttacttcgatctcaaggaa
tatgacagggctgcctactttttacagggctgcaagagccagaaagcttacttcttgtac
atgtactccagatacctgtcaggggaaaagaaaaaggatgatgagacagttgatagtttg
ggacctctggaaaaaggacaggtgaaaaatgaagctctacgagaattgagagttgagctc
agcaagaaacacaaagcacaggaactggatggatttggcctttatctatatggtgttgtg
ctgcggaaactggacctggtgaaagaagcaatagatgtatttgttgaagctgctcatgtc
ctgcctttgcactggggagcctggctggaactttgcaacttgattacggataaagagatg
ctgaagttcctgtccttgccagatacatggatgaaagagttctttcttgcacacatttat
acagaactacagctgatagaggaagctctgcagaagtatcagtctctcattgatgcagga
ttttccaaaagcacttatatcatctctcagattgcagttgcctaccacaatataagagat
attgacaaagctttatccatttttaatgagctgaggaaacaagatccttacaggatagaa
aacatggacactttctccaacttactgtatgtaaggagcatgaagcctgagttgagctac
ctggctcataatctctgtgagatagacaagtaccgtgttgagacctgctgtgtaattgga
aattattatagcttgcgttcccagcatgaaaaagcagcactctatttccagagggctttg
aaactgaatcctcgttatctaggagcctggacactaatgggacatgagtatatggaaatg
aagaacacgtctgcagctatccaggcttataggcatgcaatagaagtgaacaaaagggac
tacagagcatggtatggcttgggacaaacctatgaaatcctcaaaatgccattttactgt
ctctactactaccgacgggcccaccagctcagaccaaatgattcacgtatgctggttgct
ttaggagaatgctatgagaaactcaatcagttggtggaagctaagaagtgctattggaga
gcttatgctgtgggagatgtggagaaaatggcacttgtgaaacttgccaagttgcatgaa
cagttgaatgaatctgaacaggcagctcaatgctacatcaaatacatccaggatatctat
tcctgtggggaggtagtggagcacctggaggtcagcactgcatttcgttacctggcccag
tactacttcaaatgtaagctttgggatgaagcttcagcatgtgctcagaaatgctgtgcc
ttcaatgatactagagaagaaggaaaggccctgctgcgccagatcttacagcttcgcaac
caaggagaaacatcatccacagatgttgctgctccctttttccttcctgcatccttgtca
gccaccaatactcccacacgtcgtgtctcccctctcaatctgtcttctgtaacaccatga

DBGET integrated database retrieval system