KEGG   Taeniopygia guttata (zebra finch): 100221909Help
Entry
100221909         CDS       T01082                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00590  Arachidonic acid metabolism
tgu01100  Metabolic pathways
tgu04370  VEGF signaling pathway
tgu04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100221909 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100221909 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100221909 (PTGS2)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100221909 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 100221909
NCBI-ProteinID: XP_002190785
Ensembl: ENSTGUG00000003466
LinkDB All DBs
Position
8
AA seq 557 aa AA seqDB search
MIITCPLSSTAEFFTWLRLALKPSPNTVHYILTHFQGVWNIINNIPFLRDAIMRYVLTSR
SHLIDSPPTYNSDYSYKSWEAYSNLSYYTRSLPPVGLDCPTPMGVKGKKELPDSKLIVEK
FLLRRKFIPDPQGTNVMFTFFAQHFTHQFFKTDQKRGPAFTRALGHGVDLNHIYGETLER
QLKLRLRKDGKLKYQMIDGEMYPPTVRDTQAEMLYPPHVPEHLRFSVGQEVFGLVPGLMM
YATIWLREHNRVCDVLKHQHPEWDDEQLFQTARLILIGETIKIVIEDYVQHLSGYHFKLK
FDPELLFNQKFQYQNRIAAEFNTLYHWHPLLPDTFQINDQEYTFQQFLYNNSIMLEHGLS
HMVKSFSKQSAGRVAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEYRKRFMLKPFRSFEE
LTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEMGAPFSLKGLMGNAIC
SPEYWKPSTFGGKVGFDIVNTASLQKLICNNVKGCPFTAFHILPPEPTEATINVSTSKTA
MEDINPTLLLKERSAEL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgataataacctgcccactgtcgtccacagcggaattcttcacgtggctgaggctagca
ctgaaaccatcgccaaacactgtccactacatcctcacccacttccaaggagtctggaat
atcatcaacaacattcccttcttaagggacgctattatgagatatgtactaacgtcaaga
tcacacttgattgacagcccaccaacttacaatagtgactacagttacaaaagctgggaa
gcttattccaatctttcctactacacaagaagccttccaccagtaggacttgactgccca
acaccaatgggtgttaaaggtaagaaagagctcccggattcaaagctgatcgtggagaag
tttttgctgaggagaaagtttattcccgacccgcaaggcacaaacgtgatgttcacgttc
tttgcccagcacttcacccaccagttcttcaagacggaccagaagcggggccctgccttc
accagagcgctcggccacggggttgacttgaaccacatttatggagagactctggagaga
caacttaaactgaggcttcgaaaggatggaaagctaaaataccagatgatcgatggagaa
atgtacccgccgacggtgcgggacacgcaggcagagatgctgtacccaccccacgtgccc
gagcacctgcgcttctccgtggggcaggaggtgttcgggctggtgccagggctgatgatg
tacgccacgatctggctgcgtgagcacaaccgcgtctgcgacgtgctcaagcaccagcac
cccgagtgggacgacgagcagctcttccagaccgcccggctcattctgatcggagagaca
atcaagatcgttatagaggactatgtgcagcacctgagtgggtaccacttcaagctgaag
tttgaccccgagctgctgttcaaccagaagttccagtaccagaaccgcatcgcagccgag
ttcaacaccctgtaccactggcacccactgctgcccgataccttccagatcaacgaccag
gagtacaccttccagcagttcctctacaacaactccatcatgctggagcacggactgtcc
catatggtcaaatctttctccaagcaaagtgctggcagggttgctggtgggaagaatgtt
cctgctgcagtacagaaagtggcaaaggcctccattgaccaaagcaggcagatgaggtac
cagtccttgaacgagtacaggaaacgcttcatgctgaaaccattccgatccttcgaagaa
cttacaggagaaaaagagatggcagcggagctggaggagctgtacggggacatcgatgcc
atggagctgtaccccggcctgctggtggagaagccccggcccggggccatctttggcgag
accatggtggagatgggggcaccgttctccctgaaggggctgatgggcaacgccatctgc
tcccctgagtactggaagcccagcaccttcgggggcaaggtgggcttcgacatcgtcaac
acggcctctctgcagaagctcatctgcaacaacgtgaagggctgtcccttcaccgccttc
cacatcctgcctcccgagcccaccgaggccacgattaacgttagtacctcaaaaactgcc
atggaagatatcaaccccacgctcctgctgaaagagcgctctgccgagctgtag

DBGET integrated database retrieval system